9,676 Free Photos of Three

cc-zerofiles uploaded by daderotcc-pd-markanimalsauthor died more than 100 years ago public domain imagesphotos taken with camera trapsjuniper dunes wildernessvehicleaircraftmilitary
Three critter cams were set up in the Juniper Dunes Wilderness Area in eastern Washington from June 24 until Aug. 18, 2015. While many species came to check out the water stations we did have some ham
animalsbird
Three critter cams were set up in the Juniper Dunes Wilderness Area in eastern Washington from June 24 until Aug. 18, 2015. While many species came to check out the water stations we did have some ham
animalsbird
Three critter cams were set up in the Juniper Dunes Wilderness Area in eastern Washington from June 24 until Aug. 18, 2015. While many species came to check out the water stations we did have some ham
animalsbird
Three critter cams were set up in the Juniper Dunes Wilderness Area in eastern Washington from June 24 until Aug. 18, 2015. While many species came to check out the water stations we did have some ham
animalsbird
Adoration of the Three Kings, Monogrammist HE, Lower Bavaria, c. 1720-1740, ivory - Hessisches Landesmuseum Darmstadt - Darmstadt, Germany -DSC00563
self-published workcc-pd-mark
Katsuma (cross of pestles with three-pronged ends), Kamakura period, 13th century, gilt bronze - Tokyo National Museum - DSC05185
animalsgold
US Navy 040816-N-3019M-003 Steelworker 2nd Class Joshua Scaturo assigned to Naval Mobile Construction Battalion Four One Three (NMCB-413) waits for the starting whistle to requalify on an M-16
people at pearl harbormales with m16 rifle
US Navy 091117-N-9500T-165 Naval Aircrewman 2nd Class Bryan Vesce prepares to jump from an SH-60B Sea Hawk helicopter to rescue three men
militaryaircraft
US Navy 061230-N-8907D-001 An F-A-18C Hornet assigned to the Wildcats of Strike Fighter Squadron Eight Three (VFA-83), lands on the flight deck of the Nimitz-class aircraft carrier USS Dwight D. Eisenhower (CVN 69
militaryaircraft
US Navy 070108-N-8907D-005 A plane captain signals the pilot to check the flaps of an F-A-18F Super Hornet assigned to the Jolly Rogers of Strike Fighter Squadron One Zero Three (VFA-103) aboard the Nimitz-class a
aircraftvehicle
US Navy 060622-N-7730P-053 An F-A-18C assigned to the Stingers of Strike Fighter Squadron One One Three (VFA-113) makes an arrested landing on the flight deck aboard the Nimitz-class aircraft carrier
strike fighter squadron 113 (united states navy)vehicle
US Navy 060816-N-8544C-002 Lieutenants Justin Fisher and Greg Englebert assigned to the Pro's Nest of Patrol Squadron Three Zero (VP-30) gives a tour to midshipmen
militaryaircraft
US Navy 051224-N-4374S-002 Builder 3rd Class Jonathan Martinez, assigned to Naval Mobile Construction Battalion Three (NMCB-3), applies a ceramic floor tile during the restoration project at the Providence Hall in St. Elisabet
floorgrout
US Navy 060223-N-9500T-114 Photographer's Mate 1st Class Daniel Woods, assigned to Fleet Public Affairs Center, Pacific, documents a MH-60S Seahawk assigned to Helicopter Sea Combat Squadron Three
naval air facility el centromh-60s seahawk
US Navy 031219-N-2903K-001 Santa Claus comes across the brow from the nuclear powered Los Angeles class attack submarine USS Jacksonville (SSN 699) after the submarine returned home to Naval Station Norfolk from a three-month d
peoplecity
US Navy 060815-N-9851B-005 Commander, Task Force Seven Three (CTG-73) Rear Adm. William Burke, right, looks on as Commander Philippine Fleet, Rear Adm. George T Uy, addresses U.S. and Philippine Navy participants of (CARAT) dur
united states navy images from subic baygroup
US Navy 070624-N-7981E-100 A hose team assigned to repair locker three sets a reflash watch on a simulated class alpha fire in a storeroom aboard Nimitz-class aircraft carrier USS Abraham Lincoln (CVN 72) during a general quart
puget sound naval shipyard in the 2000speople
White clove closeup
vegetablesfood
White clove closeup
vegetablesfood
Antonio san plant
patternsnature
Heartsease (Viola tricolor)
springplants
Vertical terrycloth towel
springsummer
Statue figurine maternity
childrenmother
Eiger west side gorge jungfrau region
landscapemountain
Business portrait start up
businessmonkey
Schlei 3-mast schooner traditional ship
vehiclefish
Huningue werdenfelser land alsace
franceriver
2014-07-16_Etape_11_du_Tour_de_France._Caravane_Cochonou_2._Free_image._No_copyright._Spielvogel
self-published workhand wave
Sword with ring-shaped pommel in dragon design, attributed to Changnyeong, Korea, Three Kingdoms period, 500s AD - Tokyo National Museum - Tokyo, Japan - DSC08152
self-published workgold
Three-part window by Hans Christiansen, Karl Engelbrecht, Hamburg, 1899, stained glass - Hessisches Landesmuseum Darmstadt - Darmstadt, Germany - DSC01023
self-published workcolor
Three Cosplayers of Hanayo Koizumi, Nico Yazawa and Rin Hoshizora from Love Live! at FFK8 20151129
self-published workcc-zero
US Navy 061205-N-XXXXW-003 Naval Mobile Construction Battalion One (NMCB-1), Executive Officer, Lt. Cmdr. Eric J. Hawn, greets his three children after returning from the battalion's six-month deployment to the Far East
celebritiesgroup
US Navy 060308-N-0000X-001 A Standard Missile Three (SM-3) is launched from the Ticonderoga-class cruiser USS Lake Erie (CG 70) during a Missile Defense Agency, and Japan Defense Agency cooperative flight test mission
launches of rim-161 standard sm-3missile launches by night
US Navy 060601-N-4205W-004 Officer in Charge Anti-Submarine Squadron Light Three Seven (HSL-37) Detachment 5, Lt. Cmdr. Colin Smith, explains the capabilities of the SH-60B Seahawk helicopter
helicopter maritime strike squadron 37 (united states navy)cooperation afloat readiness and training 2006
US Navy 050310-N-1464F-011 Builder Constructionman Apprentice Dustin Baugus, assigned to Naval Mobile Construction Battalion One (NMCB-1), lays bricks to construct a new three-room schoolhouse for children in Gonaives, Haiti
builder (united states navy)schools in gonaïves
US Navy 050531-N-0000X-086 Photographers practiced a new Nikon Creative Lighting System while photographing an SH-60 helicopter from Helicopter Sea Combat Squadron Three (HSC-3), at Naval Air Station North Island
naval air station north island in the 2000saviation
US Navy 090322-N-8273J-344 A lookout aboard the Los Angeles-class submarine USS Annapolis (SSN 760) stands watch from the bridge after breaking through three feet of ice while participating in Ice Exercise (ICEX) 2009
submarines surfaced through polar icearctic ocean
US Navy 070420-N-0555B-186 Machinery Repairman 2nd Class Brandon Yahr is welcomed home with a kiss after returning from a three-month deployment aboard USS Ronald Reagan (CVN 76)
naval ship arrivals to naval air station north islandgroup
US Navy 070126-N-9928E-077 Aviation Structural Mechanic 3rd Class Osvaldo Medrano prepares an EA-6B Prowler, assigned to Tactical Electronic Warfare Squadron One Three Eight (VAQ-138), for painting aboard Nimitz-class aircraft
aircraftvehicle
US Navy 070208-N-8907D-004 A Sailor assigned to theRampagers of Strike Fighter Squadron Eight Three (VFA-83) wipes down an F-A-18C Hornet on the flight deck of Nimitz-class aircraft carrier USS Dwight D. Eisenhower (CVN
strike fighter squadron 83 (united states navy)aboard uss dwight d. eisenhower (cvn-69)
US Navy 080712-N-1424C-055 Seaman Michael Cain, left, Engineman 3rd Class Nicholas Dahlin and Seaman Nancy Torres, all three assigned to Amphibious Construction Battalion (ACB) 1, ride a Zodiac inflatable boat through the surf
beaches of marine corps base camp pendletonjoint logistics over the shore
Three critter cams were set up in the Juniper Dunes Wilderness Area in eastern Washington from June 24 until Aug. 18, 2015. While many species came to check out the water stations we did have some ham
animalsbird
Three critter cams were set up in the Juniper Dunes Wilderness Area in eastern Washington from June 24 until Aug. 18, 2015. While many species came to check out the water stations we did have some ham
animalsbird
Three critter cams were set up in the Juniper Dunes Wilderness Area in eastern Washington from June 24 until Aug. 18, 2015. While many species came to check out the water stations we did have some ham
animalsmammals
Three critter cams were set up in the Juniper Dunes Wilderness Area in eastern Washington from June 24 until Aug. 18, 2015. While many species came to check out the water stations we did have some ham
animalsmammals
Three critter cams were set up in the Juniper Dunes Wilderness Area in eastern Washington from June 24 until Aug. 18, 2015. While many species came to check out the water stations we did have some ham
animalsmammals
Three critter cams were set up in the Juniper Dunes Wilderness Area in eastern Washington from June 24 until Aug. 18, 2015. While many species came to check out the water stations we did have some ham
animalsmammals
Three critter cams were set up in the Juniper Dunes Wilderness Area in eastern Washington from June 24 until Aug. 18, 2015. While many species came to check out the water stations we did have some ham
animalsmammals
Color colorful delicious
healthfood
Crown ornament in the shape of a wing, attributed to Changnyeong, Korea, Three Kingdoms period, 500s AD, gilt bronze - Tokyo National Museum - Tokyo, Japan - DSC08140
self-published workcc-pd-mark
Hamburger with Navarra cheese and black pepper mustard on three grain German bread - Massachusetts
platefood
A domestic pig on an organic farm in Solothurn, Switzerland. On this farm two to three piglets are raised at a time. The pigs are fed cooked potatoes, amongst other things. They are out in the fresh a
animalsmammals
cross section: Nerium leaf common name: Oleander magnification: 400x Both the adaxial and abaxial epidermis in Nerium are multiseriate, being composed of up to three layers of compactly arranged cells
plantspurple
Play strategy game two people
symbolheart
US Navy 061221-N-1328C-059 Marine Corps Sgt. Jeremy Gutierrez from Amarillo, Texas, directs students from the special brigade of the Djiboutian national police, during a three-day training on a range of topics from basic weapon
camp lemonnierpeople
Javory v Kyšicích ("Maples in Kyšice"), protected group of three Silver Maples (Acer saccharimum) in village of Kyšice, Kladno District, Central Bohemian Region, Czech Republic.
watertree
Worshipping king arch ornament, perhaps Liebfrauenkirche, by the Master of the Three Kings Portal of Frankfurt, Mainz, c. 1400, sandstone - Hessisches Landesmuseum Darmstadt - Darmstadt, Germany - DSC00149
self-published workcc-pd-mark
Three animal figures (tiger), China, Zhanguo period, 475-221 BC, wood with lacquer decoration - Linden-Museum - Stuttgart, Germany - DSC03531
self-published workcc-pd-mark
Three animal figures (phoenix), China, Zhanguo period, 475-221 BC, wood with lacquer decoration - Linden-Museum - Stuttgart, Germany - DSC03530
self-published workcc-pd-mark
Three tiles, said to come from a mosque in Damascus, Syria, possibly early 1800s, ceramic - Harvard Semitic Museum - Cambridge, MA - DSC06084
self-published workcc-pd-mark
Urn clock with three graces, unidentified, view 2 - Museo Nacional de Artes Decorativas - Madrid, Spain - DSC08342
self-published workcc-pd-mark
Dressing Commode with Three Graces, Chippendale, late 1700s, marquetry on satinwood with rosewood insets - Yellow Drawing Room - Harewood House - West Yorkshire, England - DSC01891
indoorgold
Calligraphy in cursive script, three Chinese-style poems, by Kameda Bosai (1752-1826), Edo period, 1819, six panel folding screen, one of a pair, ink on paper - Asian Art Museum of San Francisco - DSC01463
self-published workindoor
Italy mountains hiking
landscapenature
Javory v Kyšicích ("Maples in Kyšice"), protected group of three Silver Maples (Acer saccharimum) in village of Kyšice, Kladno District, Central Bohemian Region, Czech Republic.
watertree
US Navy 070301-N-4420S-205 Three Sailors assigned to the Black Aces of Strike Fighter Squadron (VFA) 41, arm a missile and bomb rack to an F-A-18E Super Hornet aboard nuclear-powered aircraft carrier USS Nimitz (CVN 68)
militaryarmy
US Navy 070128-N-7130B-050 Watching the hand signals of an aircraft handler on the flight deck of USS Ronald Reagan (CVN 76), a pilot assigned to the Stingers of Strike Fighter Squadron One One Three (VFA-113) is directed into
aircraftvehicle
US Navy 070313-N-8158F-105 Electronics Technician 3rd Class Rick Pfeifer embraces his three-month old daughter for the first time at the homecoming ceremony for guided missile cruiser USS Bunker Hill (CG 73)
military people of the united states with childrencelebrities
US Navy 040226-N-4374S-003 An aircraft director signals to an EA-6B Prowler assigned to the Scorpions of Electronic Attack Squadron One Three Two (VAQ-132) to taxi forward on catapult number one
aboard uss john f. kennedy (cv-67)vehicle
US Navy 041106-N-8704K-003 The portside wing on an F-A-18 assigned to the Blue Blasters of Strike Fighter Squadron Three Four (VFA-34) is loaded with the Navy's latest Satellite Guided Bomb, the GBU-38
aboard uss john f. kennedy (cv-67)f/a-18c hornet on flight decks
US Navy 050124-N-6363M-004 An F-A-18C Hornet assigned to the Bulls of Strike Fighter Squadron Three Seven (VFA-37) launches off one of the four steam-powered catapults aboard the Nimitz-class aircraft carrier USS Harry S. Truma
militaryaircraft
US Navy 050820-N-0793G-205 The amphibious transport dock USS Ogden (LPD 5) is assisted by tug boats as she arrives at Ketchikan for a three-day port visit after successfully completing Northern Edge 2005
boatship
US Navy 060830-N-9818V-191 Gunner's Mate Seaman Justin Baker, assigned to Inshore Boat Unit One Three (IBU-13), mans a 7.62mm M-240 machine gun while conducting fast boat maneuvers during exercise Seahawk 2006
san diego-coronado bridgem-240 machine gun
People summer landscape
landscapehealth
Politicians campaigning in Minato-ku for municipal elections 05
vehiclecar
Lailly-en-Val (Loiret) Église, vitrail 08
self-published workpages with maps
Maid with food, China, unearthed at Tujing, Zhongxian, Chongqing City, Shu Kingdom, Three Kingdoms, 221-263 AD, ceramic - Sichuan Provincial Museum - Chengdu, China - DSC04772
self-published workcc-pd-mark
Three animal figures (deer), China, Zhanguo period, 475-221 BC, wood with lacquer decoration - Linden-Museum - Stuttgart, Germany - DSC03529
self-published workcc-pd-mark
Alm nature italy
landscapewater
Four-legged jar, attributed to Buyeo, Korea, Three Kingdoms period (Baekje), 500s AD, ceramic - Tokyo National Museum - Tokyo, Japan - DSC08155
self-published workcc-pd-mark
Église_Saint-Nicolas_de_Courcelles,_vitrail_l._une_sainte,_r._St.Nicolas
self-published workarchitecture
City of Norwich in New York State 30 Catholic church
self-published workarchitecture
US Navy 040825-N-8704K-002 A S-3B Viking assigned to the Diamond Cutters of Sea Control Squadron Three Zero (VS-30), conducts in-flight refueling during flight operations in support of Operation Iraqi Freedom (OIF)
aircraftvehicle
US Navy 091012-N-1831S-133 Three landing craft, air cushions (LCAC) are launched from the amphibious assault ship USS Bataan (LHD 5) during the biennial, multinational exercise Bright Star 2009
vehicleboat
US Navy 100526-N-5483N-051 Personnel Specialist 3rd Class Anthony Hodge helps Yeoman 3rd Class Zachary Williams with a self-contained breathing apparatus during a three-day damage control training course
self-contained breathing apparatuspeople
US Navy 030320-N-6141B-001 The Arleigh Burke class guided missile destroyer USS Donald Cook (DDG 75) launches three of its Tomahawk Land Attack Missiles (TLAM) at military targets in Iraq
lightdark
US Navy 051008-N-9693M-018 U.S. Naval Academy Midshipmen kicker Joey Bullen kicks a field goal with 4-10ths of a second left in the game against Air Force for three points
sportgame
US Navy 051022-N-9769P-298 Accelerating through turn number three during the Sam's Town 250 race at Memphis Motor Sports Speedway
united states navy in millingtontennessee
US Navy 041112-N-3019M-001 An SH-60B Seahawk helicopter assigned to the Easy Riders of Helicopter Anti-submarine Squadron Light Three Seven (HSL-37), arrives ahead of a UH-3H Sea King helicopter
helicopter maritime strike squadron 37 (united states navy)uh-3h sea king
US Navy 050126-N-6363M-010 An EA-6B Prowler assigned to the Zappers of Electronic Attack Squadron One Three Zero (VAQ-130) is launched off one of the four steam-powered catapults
militaryvehicle
US Navy 070203-N-5345W-025 A T-45 Goshawk assigned to Training Airwing Two (TRAWING-2) catches the number three wire while making an arrested recovery aboard Nimitz-class aircraft carrier USS Harry S. Truman (CVN 75)
vehiclenavy
US Navy 050520-N-7265L-017 Crash and Salvage crew members attach a tow-bar to an EA-6B Prowler assigned to the Yellow Jackets of Electronic Attack Squadron One Three Eight (VAQ-138)
militaryaircraft
US Navy 060818-N-9851B-003 - Philippine Navy Capt. Orwen Cortez, Capt. Al Collins and Philippine Marine Lt. Col. Emmanuel Salamat talk after debarking landing craft air cushion Seven Three (LCAC 73)
san antoniopeople
US Navy 061201-N-6106R-081 The carrier on-board delivery (COD) crew from Fleet Logistics Support Squadron Three Zero (VRC-30) lifts a fuel hose to help other Sailors move mail and supplies across USS Kitty Hawk's (CV 63)
fleet logistics support squadron 30 (united states navy)aboard uss kitty hawk (cv-63)
US Navy 070624-N-7981E-152 A hose team leader assigned to repair locker three uses a Naval Firefighter's Thermal Imager (NFTI) to direct a nozzleman to hotspots on a simulated class alpha fire in a storeroom aboard Nimitz-class
puget sound naval shipyard in the 2000speople
Lewis Payne cwpb.04208 (cropped)
monochromehandcuffs
Jubileumsmynt, 1821. Frånsida; förställande Gustav I, Gustav II Adolf samt Fredrik I - Skoklosters slott - 109311
planetcircle
US Navy 061030-F-7426P-038 Officer in Charge of U.S. Navy Explosive Ordnance Disposal Mobile Unit Three (EODMU-3) Lt. A. J. Pajack, conduct a predeparture convoy brief with a Latvian army convoy commander
militaryarmy
Javory v Kyšicích ("Maples in Kyšice"), protected group of three Silver Maples (Acer saccharimum) in village of Kyšice, Kladno District, Central Bohemian Region, Czech Republic.
watertree
Scouts boys brother
foodtree
4701 - 4800 of 9,676 Next page
/ 97