16,916 Free Photos of P

cc-zerovehicleanimalsmilitaryaircraftplantspages with mapsbirdaviationflight
US Navy 111207-N-DR144-276 Airman Mikel Thompson is assisted by Logistics Specialist 2nd Class Arthur Simpson as he practices donning his MCU-2P p
aboard uss carl vinson (cvn-70)people
Oslob Whale Shark Watching, Tan-awan Oslob, Philippines
underwaterocean
US Navy 041113-N-0331L-010 Ens. Eduardo Sanchez from Argentine ship ARA Spiro (P 43), fires a .50 caliber machine gun aboard the Oliver Hazard Perry class frigate USS Dewert (FFG 45) as part of a gunnery exercise during UNITAS
muzzle flashes of firearmssea
J. P. Rizal Extension, District II, Makati City 14°33'46"N 121°3'34"E J. P. Rizal Street 14°34'18"N 121°0'57"E District II, List of barangays of Metro Manila, Legislative districts of Makati, Baranga
shoppingfood
Personenzuglok the long-running tender p8
vehicletoy
Nissan SKYLINE 350GT FOUR HYBRID Type P (V37) rear
vehiclecar
Lockheed - Mitsubishi F-104J Starfighter - Eikō ‘515 - 36-8515 - A-P-W’ (28315028848)
militaryvehicle
J-52-P-408 Turboject, Pratt & Whitney - Oregon Air and Space Museum - Eugene, Oregon - DSC09716
aircraft engines in the oregon air and space museumself-published work
Messerschmitt ME 1101
militaryvehicle
Metz Le Met' Van Hool Exquicity 24 n°1320 MA P+R Rochambeau (4)
self-published workvehicle
US Navy 110826-N-AW342-163 Rear Adm. Richard Breckenridge, commander of Carrier Strike Group (CSG) 2, is rendered honors
people at naval submarine base new londoncelebrities
US Navy 100108-N-5423C-052 Cmdr. Jessica M. Pfefferkorn, commanding officer of Naval Support Activity Panama City and Cmdr. Timothy P. Richardt, commanding officer
naval support activity panama citygarry c. dean
US Navy 110825-N-ZI300-002 Sailors aboard the guided-missile frigate USS Thach (FFG 43) prepare to arrive in Panama City, Panama for the close of P
boatsea
US Navy 120113-N-AW342-005 Capt. Michael Holland, commodore of Submarine Squadron (SUBRON) 2, speaks to Sailors assigned to the Los Angeles-class a
michael p. hollandpeople
US Navy 111214-N-DR144-047 Aircrew Survival Equipmentman 3rd Class Haley Craft deflates air bladders for LPU-34B-P low-profile floatation collars i
aboard uss carl vinson (cvn-70)bladder
US Navy 110606-N-NY820-130 Hospital Corpsman 2nd Class Antonio Carranza, from Santa Ana, Calif., conducts a subject matter expert exchange on CPR p
peoplegroup
US Navy 110407-N-DR144-338 Aviation Support Equipment Technician Airman Scott Jensen secures panels after adjusting the fuel injectors on a P-25 fi
aboard uss carl vinson (cvn-70)p25 fire engine
P-34 was found lying on this trail by a hiker in Point Mugu State Park on September 30. Preliminary results from the necropsy indicate she may have died as a result of rodenticide poisoning. Courtesy
animalsmammals
Image title: White fish humpback fishes Image from Public domain images website, http://www.public-domain-image.com/full-image/fauna-animals-public-domain-images-pictures/fishes-public-domain-images-p
coregonus pidschian
IdentificatieTitel(s): AriadneVrouwen uit de klassieke mythologie (serietitel)Objecttype: prent Serienummer: 3/6Objectnummer: RP-P-OB-54.336Catalogusreferentie: Hollstein German 43Opschriften / Merken
german prints in the rijksmuseum amsterdamnikolaus solis
IdentificatieTitel(s): Ariadne zittend op een panter; vooraanzichtAanzichten van het beeld van Heinrich von Dannecker van Ariadne op de panter (serietitel) Objecttype: prent Objectnummer: RP-P-2013-24
uncategorized images of the rijksmuseum
IdentificatieTitel(s): Bacchus vindt Ariadne op NaxosObjecttype: prent Objectnummer: RP-P-1880-A-4199Catalogusreferentie: Hollstein Dutch 47-3(3)Opschriften / Merken: verzamelaarsmerk, verso linksonde
prints by moyses van wtenbrouck in the rijksmuseum amsterdamdionysos and ariadne
J. P. Rizal Extension, District II, Makati City 14°33'46"N 121°3'34"E J. P. Rizal Street 14°34'18"N 121°0'57"E District II, List of barangays of Metro Manila, Legislative districts of Makati, Baranga
peopleplants
J. P. Rizal Extension, District II, Makati City 14°33'46"N 121°3'34"E J. P. Rizal Street 14°34'18"N 121°0'57"E District II, List of barangays of Metro Manila, Legislative districts of Makati, Baranga
convolvulaceaeplants
Oldtimer model buses transport and traffic
trafficmodel
Rocks stones rounded
landscapescenes
The tire wheel of Nissan SKYLINE 350GT HYBRID Type P (V37)
vehiclecar
P-51 Mustang Alliance Air Show 06
aircraftvehicle
Curtiss-Wright P-47G-10-CU - TP-47G-CU Thunderbolt 'WZ-D - 225068' (G-CDVX) (26024429021)
militaryvehicle
Seulberger Mark, Grenzstein GI OE, HH SR P (2), Petterweiler Seite
leavesrock
Hippo n Baby P Zoo
self-published workpd us no notice
Nissan SKYLINE 350GT HYBRID Type P (HV37) front
vehiclecar
7th Fleet Vice Adm. Aucoin transits to USS Ronald Reagan 151124-N-EI558-017
people at naval air facility atsugiuss ronald reagan (cvn-76)
US Navy 010304-A-0000J-002 Christening of the Ronald Reagan CVN 76
christening of uss ronald reagan (cvn-76)george w. bush in march 2001
US Navy 060217-N-8726C-006 A Sailor assigned to the Tridents of Patrol Squadron Two Six (VP-26), makes last minute adjustments to equipment prior to the launch of a P-3 Orion
naval air station sigonella in the 2000sdark
US Navy 110526-N-PO203-066 Rear Adm. Nevin P. Carr, Chief of Naval Research, speaks with research managers about the Railgun on display at Pier 88
militarynavy
US Navy 110713-N-YR391-049 A Sailor aboard the aircraft carrier USS Enterprise (CVN 65) observes from the forecastle as Enterprise approaches the p
stockless anchormetal
US Navy 110514-N-OS574-168 Sailors and Marines from the San Antonio-class amphibious transport dock ship USS Mesa Verde (LPD 19) p
boatsea
US Navy 051221-N-9866B-625 U.S. Naval Academy Superintendent Vice Adm. Rodney Rempt cheers at a pep rally
aboard uss peleliu (lha-5)group
US Navy 101028-N-8623S-019 Naval Air Crewman (Mechanical) 2nd Class J.J. Schumacher, a P-3 Orion assistant flight engineer assigned to Patrol Squad
united states navy images from misawaflight engineer
160311-N-QF605-014 (25582344552)
vessels of the united states sixth fleetusns spearhead (t-epf 1)
Leonotis leonurus (L.) R.Br., Monk's Cowl area, Natal Drakensberg, South Africa
natureplants
Mäuse-Gerste (Hordeum murinum) an einer Ruderalstelle in der Berlinallee in Hockenheim
poaceaeplants
William Pennington and Petr Pavel 170725-N-SO730-020 (36213549051)
bridge of the uss george h. w. bush (cvn-77)william p. pennington
IdentificatieTitel(s): Bacchus vindt Adriadne op NaxosObjecttype: prent Objectnummer: RP-P-OB-24.998Catalogusreferentie: Hollstein Dutch 47-2(3)Opschriften / Merken: verzamelaarsmerk, verso linksonder
prints by moyses van wtenbrouck in the rijksmuseum amsterdamdionysos and ariadne
Image title: Reptile eastern spadefoot toad Image from Public domain images website, http://www.public-domain-image.com/full-image/fauna-animals-public-domain-images-pictures/reptiles-and-amphibians-p
amphibiaanimals
Tausendschön monatsroeserl m p
naturespring
The tire wheel of Subaru LEGACY OUTBACK Limited (BS9)
vehiclecar
Nissan SKYLINE 350GT FOUR HYBRID Type P (HV37) front
vehiclecar
P-3C Orion 030314-N-0780F-017
militaryvehicle
Newton maid cottage (Sioux City) from N 1
building structureroof
P-51 Mustang Alliance Air Show 07
militaryvehicle
P-51 Mustang Alliance Air Show 08
aircraftvehicle
Effective conservation of the greater sage-grouse and its habitat requires a collaborative, science-based approach that includes strong federal plans, strong plans for state and private lands, and a p
animalsbird
Effective conservation of the greater sage-grouse and its habitat requires a collaborative, science-based approach that includes strong federal plans, strong plans for state and private lands, and a p
animalsbird
ICONOGRAPHIE ORNITHOLOGIQUE FI. 51. •r Coiiurus acuticauclatiis . ( (i.R. CjràY.) JPERRUCHE -ACUTICAUDE. P-OudaitpinxJetlitb. 0. des Murs, direx^ Imp.Lith. de Becauet.
animalsbird
Mäuse-Gerste (Hordeum murinum) an einer Ruderalstelle in der Berlinallee in Hockenheim
poaceaeplants
Populus tremula (not P. alba as filename states)
plantstree
Бирюлёвский дендропарк. Большая Еловая аллея. 1972-1974 гг. Обоснование точки на https://pastvu.com/p/849518
picea abiesplants
President Richard Nixon and Mrs. Nixon Hosting a White House Dinner Honoring American Labor on Labor Day
monochromepeople
US Navy 081020-N-1635S-003 Capt. John P. Nolan, commanding officer of the Ticonderoga-class guided-missile cruiser USS Chancellorsville (CG 62), observes a replenishment at sea
navigation (underway replenishment)uss chancellorsville (cg-62)
US Navy 101028-N-8623S-041 Lt. Sean O'Neill, tactical coordinator of Patrol Squadron (VP) 9, performs a sonobuoy continuity check during a prefligh
united states navy images from misawap-3 orion interiors
Vice President Michael R. Pence aboard USS Ronald Reagan 15
guests aboard uss ronald reagan (cvn-76)joseph p. aucoin in 2017
US Navy 110726-N-ZZ999-007 Adm. Patrick M. Walsh, commander of U.S. Pacific Fleet, talks with Capt. Jesse A. Wilson, mission commander of Pacific P
peoplejr
US Navy 101007-N-6770T-181 Hospital Corpsman 2nd Class Shawn P. Cairy, a reserve component Sailor, explains medications he is giving to a Filipino
san miguelbulacan
P-51 Mustang Alliance Air Show 12
militaryvehicle
P-51 Mustang Alliance Air Show 04
militaryvehicle
P-51 Mustang Alliance Air Show 03
militaryvehicle
Lockheed P-80A-5-LO Shooting Star ‘PN-488 - 485488’ (261986643794)
militaryvehicle
Gloeden, Wilhelm von (1856-1931) - n. 1121 - da - Amore e arte, p. 77
nude boys in artpeople
Ayanna Pressley speaking for Momnibus
march 2020 in washingtond.c.,
US Navy 110513-N-DU438-076 Electrician's Mate Fireman Barrett P. Smith lowers a sounding tube into a main reduction gear sump inside an engine room
engine rooms of the united states navyaboard uss gettysburg (cg-64)
US Navy 040807-N-0331L-008 Lt. Cdr. Christopher Blow walks across the snow to examine the wreckage of a Navy P-2V Neptune aircraft that crashed over Greenland in 1962
kronborg glacierpeople on ice
USS Bonhomme Richard (LHD 6) Cahemical, Biological, Radiological Drill 161130-N-AY934-067
militaryarmy
US Navy 070413-N-8102J-012 Jacksonville Mayor John Peyton addresses invited guest at the groundbreaking ceremony for the state-of-the art facility that will provide space for five P-3C Orion squadrons
military in jacksonvilleflorida
USS Donald Cook (DDG 75) and Georgian Coast Guard vessel GCG Ochamchire (P-23) in Batumi in 2021
oceansea
President Ronald Reagan during the signing ceremony for USSR-US Nuclear Risk Reduction Centers Agreement with George Shultz and Eduard Shevardnadze
relations of the soviet union and the united statescelebrities
President Ronald Reagan meets with aides on Iran-Contra
caspar weinbergerinside
US Navy 101013-N-6770T-235 t. Sean O'Neill, a pilot assigned to Patrol Squadron Nine (VP) 9, explains maritime patrol procedures aboard a P-3C Orio
united states navy images from subic baypeople
US Navy 071023-N-2653P-116 A Navy musician sings the national anthem during a ceremony recognizing the actions of Navy SEAL Lt. Michael Murphy held at the Hall of Heroes inside the Pentagon
pentagon hall of heroes ceremony for michael p. murphy
Purok or Village 5 is surrounded by Irrigation Creek, Atis Annona squamosa custard apple, atimoya, sweetsop, o sugar apple and Banana plantations, in Barangay Balite, San Miguel, Bulacan, along the P
annonaceaeplants
P-38 is a large male (130 lbs, 3-4 years old) that was captured March of 2015 on the eastern end of the Santa Susana Mountains. We are working with Caltrans to study the impact of Highway 126 on carni
animalsmammals
(170618-N-XN177-038) Joseph Aucoin speaks to members of the press about the guided-missile destroyer USS Fitzgerald (DDG 62)
uss fitzgerald (ddg-62) and mv acx crystal collision on 17 june 2017joseph p. aucoin in 2017
On April 23, BLM Range Management Specialists shot photos and video at a Sage-grouse lek near Louse Canyon geographic management area and McDermitt, Oregon. The sagebrush ecosystem is home to unique p
animalsbird
On April 23, BLM Range Management Specialists shot photos and video at a Sage-grouse lek near Louse Canyon geographic management area and McDermitt, Oregon. The sagebrush ecosystem is home to unique p
animalsbird
On April 23, BLM Range Management Specialists shot photos and video at a Sage-grouse lek near Louse Canyon geographic management area and McDermitt, Oregon. The sagebrush ecosystem is home to unique p
animalsbird
On April 23, BLM Range Management Specialists shot photos and video at a Sage-grouse lek near Louse Canyon geographic management area and McDermitt, Oregon. The sagebrush ecosystem is home to unique p
animalsbird
On April 23, BLM Range Management Specialists shot photos and video at a Sage-grouse lek near Louse Canyon geographic management area and McDermitt, Oregon. The sagebrush ecosystem is home to unique p
animalsbird
On April 23, BLM Range Management Specialists shot photos and video at a Sage-grouse lek near Louse Canyon geographic management area and McDermitt, Oregon. The sagebrush ecosystem is home to unique p
animalsbird
On April 23, BLM Range Management Specialists shot photos and video at a Sage-grouse lek near Louse Canyon geographic management area and McDermitt, Oregon. The sagebrush ecosystem is home to unique p
animalsbird
Austria collect traffic
vehicletravel
20201128_100819_November_2020_in_Białystok
self-published workcc-zero
Candidate for Congress NJ-7th Tom Malinowski at campaign headquarters speaking with a voter
self-published workcc-zero
P (213531171)
landscapenature
P Hall bannisters
self-published workarchitecture
North American P-51D-25-NT Mustang ‘G4-U - 413334’ “Wee Willy II” (NL7715C) (25693974011)
militaryvehicle
J-52-P-408 Turboject detail, Pratt & Whitney - Oregon Air and Space Museum - Eugene, Oregon - DSC09717
aircraft engines in the oregon air and space museumself-published work
Gloeden, Wilhelm von (1856-1931) - n. 2125 - da - Sicilia mitica Arcadia - p. 65
film photographypeople
Gloeden, Wilhelm von (1856-1931) - n. 1185 - da - Amore e arte, p. 91
black and whitemonochrome
US Navy 040809-N-0331L-002 Recovery personnel examine the wreckage of a Navy P-2V Neptune aircraft that crashed over Greenland in 1962
landscapemountain
5801 - 5900 of 16,916 Next page
/ 170