94,985 Free Photos of Navy

images from united states navy to checkunited states navy bandgroupus navy picture of the daymilitaryaircraftshiparmyvehicleboat
Flickr - Official U.S. Navy Imagery - A new chief receives his combination cover. (3)
images from united states navy to check
Flickr - Official U.S. Navy Imagery - A Sailor acts as the sound-powered phone talker.
images from united states navy to checkpeople
Flickr - Official U.S. Navy Imagery - A Sailor takes a photo aboard USNS Mercy.
images from united states navy to checkwhite
Flickr - Official U.S. Navy Imagery - A Sailor fires the messenger line.
heaving lineswords
Flickr - Official U.S. Navy Imagery - A Sailor guides in a pallet of supplies during a replenishment at sea.
images from united states navy to check
Flickr - Official U.S. Navy Imagery - A Sailor operates a crane during well deck operations.
images from united states navy to check
Flickr - Official U.S. Navy Imagery - A Sailor welds a bracket in the sheet metal shop. (1)
images from united states navy to check
Flickr - Official U.S. Navy Imagery - A U.S. Marine with pneumonia is transported to Hawaii for further treatment.
images from united states navy to check
Flickr - Official U.S. Navy Imagery - An officer looks through a stadimeter.
seasun
Flickr - Official U.S. Navy Imagery - Aviation ordnancemen move ordnance across the flight deck.
images from united states navy to check
Flickr - Official U.S. Navy Imagery - Boatswain's Mate 3rd Class Donte Ruffin signals.
images from united states navy to check
Flickr - Official U.S. Navy Imagery - Carl Vinson Sailors wave at passing INS Satpura.
images from united states navy to check
Flickr - Official U.S. Navy Imagery - Sailor checks equipment before salvage operation in Japan.
images from united states navy to check
Flickr - Official U.S. Navy Imagery - Members of the press raise their hands to ask the CNO questions
images from united states navy to check
Flickr - Official U.S. Navy Imagery - Sailor holds cable during replenishment at sea evolution.
images from united states navy to check
Flickr - Official U.S. Navy Imagery - Sailors check the course of USS New Orleans.
images from united states navy to checkteam
Flickr - Official U.S. Navy Imagery - Sailor reviews paperwork aboard USS Carl Vinson.
images from united states navy to check
Flickr - Official U.S. Navy Imagery - Sailor stands among spinning rifles.
militaryarmy
Flickr - Official U.S. Navy Imagery - Sailors don fire fighting gear.
peoplegroup
Fernch Navy sabre mg 8421
weapons in musée de la marine de port-louisfrench navy sabre model 1833
Flickr - Official U.S. Navy Imagery - Sailors assist with Hurricane Sandy clean-up. (20)
images from united states navy to check
Flickr - Official U.S. Navy Imagery - Sailors assist with Hurricane Sandy clean-up. (15)
images from united states navy to check
Flickr - Official U.S. Navy Imagery - Sailors man the rails after completing a replenishment at sea.
images from united states navy to check
Flickr - Official U.S. Navy Imagery - Sailors man the rails as USS O'Kane departs for a deployment.
images from united states navy to check
Flickr - Official U.S. Navy Imagery - Sailors disembark USS McInerney during decommissioning ceremony.
images from united states navy to check
Flickr - Official U.S. Navy Imagery - Sailors fire an air slug from a torpedo tube.
images from united states navy to check
Flickr - Official U.S. Navy Imagery - Sailors practice general quarters.
nighttimenight
Flickr - Official U.S. Navy Imagery - Sailors learn proper gun handling.
peoplegroup
Flickr - Official U.S. Navy Imagery - Sailors secure USS Crommelin upon its return.
images from united states navy to check
Flickr - Official U.S. Navy Imagery - Sailors stand by to relieve hose team members.
images from united states navy to checkpeople
Flickr - Official U.S. Navy Imagery - Sailors take part in a stationary relay race.
images from united states navy to checkgroup
Flickr - Official U.S. Navy Imagery - Sailors participate in total resistance exercise in the hangar bay.
images from united states navy to check
Flickr - Official U.S. Navy Imagery - Sailors sing in the choir during Easter church services.
images from united states navy to check
Flickr - Official U.S. Navy Imagery - Sailors stand by to fight a simulated aircraft fire.
images from united states navy to checkpeople
Flickr - Official U.S. Navy Imagery - The CNO speaks at the Sailor of the Year pinning ceremony at the U.S. Navy Memorial.
jonathan w. greenert in 2012
Flickr - Official U.S. Navy Imagery - Sailors wait to launch a jet.
aircraftvehicle
Flickr - Official U.S. Navy Imagery - SOYs are advanced to chief petty officers. (1)
images from united states navy to checkcelebrities
Flickr - Official U.S. Navy Imagery - USS Cowpens as seen from the top of the forward mast.
images from united states navy to check
Flickr - Official U.S. Navy Imagery - USNS Supply replenishes USS Porter and USS Enterprise.
images from united states navy to check
Flickr - Official U.S. Navy Imagery - USS Carl Vinson Sailor reassembles a turbofan (1)
images from united states navy to check
Flickr - Official U.S. Navy Imagery - USS Chafee is underway.
boatsea
Flickr - Official U.S. Navy Imagery - USS Mason underway with Enterprise Carrier Strike Group.
images from united states navy to check
Flickr - Official U.S. Navy Imagery - USS New Orleans conducts a live-fire exercise.
images from united states navy to check
Flickr - Official U.S. Navy Imagery - USS Preble arrives in San Francisco.
architecturewater
Flickr - Official U.S. Navy Imagery - USS Stockdale Sailors take part in a refueling at sea.
images from united states navy to check
Flickr - Official U.S. Navy Imagery - USS Stockdale Sailors prepare to depart Republic of Korea.
images from united states navy to check
Flickr - Official U.S. Navy Imagery - USS Ronald Reagan's navigator checks the ship's position.
images from united states navy to check
US Navy 040618-N-0000X-001 U.S. Navy file photo of Vice Adm. John B. Nathman
john b. nathman
US Navy 010924-N-0063S-501 USS Bataan (LHD 5)
vehiclenavy
US Navy 021030-N-0000X-065 U.S. Navy file photo of Rear Adm. James M. Walley
james m. walley
US Navy 021024-N-4374S-030 Sailors assigned to the
aircraftvehicle
US Navy 021101-N-4374S-024 P-3C Orion on a routine mission
patrol squadron 1 (united states navy)people
USS Fort Worth connects a fuel line during a replenishment-at-sea. (19353342453)
boatship
US Navy 060613-N-4034B-011 U.S. Navy Reservists conduct an ammunition loading operations during Colonial Outlook
williamsburgvirginia
USS Carl Vinson conducts flight operations. (17021947941)
militaryvehicle
US Navy 080903-N-9123L-002 The color guard parade the colors
united states navy images from australiapeople in melbourne
US Navy 081107-N-9689V-005 A wreath, placed in memory of one of the U.S. Navy
vietnam unit memorial monumentmemorial wreaths
US Navy 110817-N-YM590-001 Sailors fish off the fantail
boatship
US Navy 101210-N-6436W-010 Seabees enjoy downtime in a small tent
united states navy images from khvājeh molk
US Navy 090916-N-4063H-002 Intelligence Specialist
intelligence specialistvirginia
US Navy 090609-N-3013W-036 Sailors assigned to the
landscapeflorida
Bossier City Shreveport Navy Week 150427-N-VN372-052
united states navy recruiting commandindoor
Navy Band visits New Orleans jazz conference January 2020 03
january 2020 in new orleansunited states navy band
Navy hosts Regional SePerch Competition in San Antonio 170225-N-ND850-600
indoorgroup
Navy Band Holiday Concert (31794389325)
lightnight
Navy Band visits New Orleans jazz conference January 2020 02
january 2020 in new orleansunited states navy band
Navy Band visits New Orleans jazz conference January 2020 01
january 2020 in new orleansunited states navy band
Navy Marine Corps Classic 2012 121104-N-PW661-042
people at naval station mayportnavy
Navy hosts Regional SePerch Competition in San Antonio 170225-N-ND850-411
groupgame
Rear Adm. Michael White meets with a Rotary Club during Cheyenne Navy Week. (19588017140)
insidelight
140320-N-LC494-003 (13291023064)
united states navy bandnavy commodores
NTS Farragut Idaho US Navy Nurse Corps RNs ca1943
navy nurse corps (united states)farragut naval training station
110316-N-2257C-002 (5542589489)
united states navy bandpeople
150427-N-DX698-062 (18347424832)
people of the united states navy at joint base pearl harbor-hickamus navy picture of the day
160607-ESPN-0656S-040-Edit (26953635724)
navy2001
Cleveland4 (33386467243)
peoplegroup
200512-N-MZ309-001 (49894425522)
u.s. navy during the covid-19 pandemic in washington (state)navy nurse corps (united states)
200513-N-MZ301-001 (49894115821)
u.s. navy during the covid-19 pandemic in washington (state)navy nurse corps (united states)
USS Stockdale (DDG 106) greets USNS Matthew Perry (T-AKE-9). (8493229770)
shipnavy
160304-N-NW255-041 (25687465356)
united states navy concert bandunited states navy band
160311-N-NW255-113 (25254965424)
united states navy concert bandunited states navy band
160311-N-NW255-140 (25766891202)
united states navy concert bandunited states navy band
120416-N-PK218-028 Royal Navy destroyer HMS Daring (D 32)
boatsea
USS Hopper returned to its homeport Joint Base Pearl Harbor-Hickam. (26351366078)
shipnavy
US Navy 111116-N-VH839-045 A Sailor conducts VBSS drills
aboard uss wayne e. meyer (ddg-108)navy
USS George Washington conducts flight operations. (11177330805)
militaryaircraft
Wreath laying commemorating the 75th anniversary of the attack on Pearl Harbor. (31678177981)
united states navy ceremonial bandunited states navy band
Wreath laying commemorating the 75th anniversary of the attack on Pearl Harbor. (31647087342)
united states navy ceremonial bandunited states navy band
US Navy 100312-N-7948C-033 Italian navy Lt. Cmdr. Marco Compasso, assigned to Africa Partnership Station (APS) West staff, speaks with a Ghanaian Sailor during a maritime domain awareness workshop aboard the amphibious dock lan
united states navy in sekondi-takoradiaboard uss gunston hall (lsd-44)
US Navy 081117-N-3610L-205 Quartermaster 3rd Class Desiree Semma uses a sound-powered phone to relay messages and update a plotting change
united states navy images from honoluluwomen in the united states navy
US Navy 100523-N-0413B-201 Navy Diver 2nd Class James Maxey, left, and Navy Diver 2nd Class Dicky Ellis, both assigned to Mobile Diving Salvage Unit (MDSU) 1, conduct post dive maintenance on a MK-3 diving helmet
joint pow/mia accounting commandunited states navy divers
US Navy 100810-N-9818V-019 The U.S. Navy Ceremonial Guard presents the colors at the Armed Forces Retirement Home during a dedication ceremony for an anchor
washingtonarmy
US Navy 110922-N-RI844-133 A Bangladesh navy sailor fires a Type-56 assault rifle aboard the Bangladesh navy frigate BNS Bangabandhu (F 25) during
military2001
Flickr - Official U.S. Navy Imagery - Aviation Ordnanceman 3rd Class Daniel Coggins and Aviation Ordnanceman Airman Eric Fernandez clear the area for an MH-60S Sea Hawk helicopter.
militaryaircraft
Anne M. Swap (2)
official portrait photographs of rear admirals (lower half) of the united states navymilitary people with the national flag of the united states in background
US Navy 091113-N-0000X-048 Sailors from the Maritime Civil Affairs and Security Training Command's Security Force Assistance Detachment pose with officers from the Royal Cambodian Navy
royal cambodian navyarmy
US Navy 101108-N-8546L-590 Chief Master-at-Arms Mike Hausmann, a U.S. Navy military working dog handler, observes a Uruguayan anti-narcotics police
dog traininguruguay
US Navy 110622-N-KB666-198 Armada de Chile sailor John Ramon, demonstrates Chilean navy dive gear to members of Mobile Diving and Salvage Unit (MD
peoplechile
US Navy 110611-N-NJ145-125 Capt. John W. Gilman and Royal Malaysian Navy Rear Adm. Nasaruddin bin Othman ign the dedication plaque during the turno
royal malaysian navypeople
US Navy 110615-N-CI293-475 U.S. Navy Band Great Lakes, Ceremonial Band, performs a patriotic medley for bikers attending the Sturgis on the River M
armyiowa
4501 - 4600 of 94,985 Next page
/ 950