8,588 Free Photos of Ade

cc-zerofiles uploaded by daderotcc-pd-markauthor died more than 100 years ago public domain imagesvehiclegoldad-6 (a-1h) skyraidermilitaryaircraftaviation
Wine coaster by Arthur & Bond, Japan, 1905 AD, silver - Peabody Essex Museum - DSC07815
self-published workcc-pd-mark
The Moon God 'Men', Roman, Anatolia, 3rd century AD, terracotta - Sackler Museum - Harvard University - DDSC01847
self-published workcc-pd-mark
Real estate document, Italy, 1362 AD, parchment - Robert C. Williams Paper Museum - DSC00429
self-published workcc-pd-mark
VW Kever brandweer pic2
vehiclecar
Bowl, Korea, Joseon dynasty, approx. 1400-1500 AD, buncheong ware, stoneware with stamped and inlaid slip decoration - Asian Art Museum of San Francisco - DSC01417
self-published workbuncheong ware
Boxing, Lien Hiep Communale house, Ha Tay province, 17th century AD, wood - Vietnam National Museum of Fine Arts - Hanoi, Vietnam - DSC04987
self-published workcc-zero
Isis restored as Ceres, Roman, 160-180 AD, marble - Galleria Borghese - Rome, Italy - DSC04811
self-published workcc-pd-mark
Mask of the Ocean, fragment, Roman, 3rd century AD, marble mosaic - Galleria Borghese - Rome, Italy - DSC04818
self-published workcc-pd-mark
Douglas A-1H A-4E CVW-16 1966
militaryvehicle
Douglas A-1H Skyraider of VA-165 pproaching USS Intrepid (CVS-11), in 1966
militaryvehicle
Douglas A-1H Skyraider of VA-176 starts its engine aboard USS Saratoga (CVA-60), in 1967
militaryaircraft
Amazon with barbarian and Greek, Roman, c. 160 AD, marble - Galleria Borghese - Rome, Italy - DSC04688
self-published workcc-pd-mark
Head of Buddha figurine, Ly-Tran dynasty, 11th-14th century AD, terracotta - National Museum of Vietnamese History - Hanoi, Vietnam - DSC05432
self-published workcc-zero
Israel Jacobson, from Seesen, 1810 AD, gouache on ivory with paper and cardboard - Braunschweigisches Landesmuseum - DSC04639
self-published workgold
Medicine Buddha, 1644-1911 AD, thangka - Sichuan University Museum - Chengdu, China - DSC06197
self-published workcc-pd-mark
Meleager, Roman, 2nd century AD, copy of Greek original, marble - Galleria Borghese - Rome, Italy - DSC04929
self-published workcc-pd-mark
Mesa Verde black-on-white mug, San Juan Anasazi, Whiskers Ruin, Utah, 1200-1300 AD, ceramic, paint - Natural History Museum of Utah - DSC07407
self-published workcc-zero
Martha Penyston monument, c. 1619 AD - Saint Mary's Church, Stowe - Buckinghamshire, England - DSC07273
self-published workcc-pd-mark
Manjusri Bodhisattva, Tibet, 1368-1644 AD, gilt copper - Sichuan Provincial Museum - Chengdu, China - DSC04392
self-published workgold
Leg of the horse, manuscript by Akutagawa Ryunosuke, 1925 AD - Edo-Tokyo Museum - Sumida, Tokyo, Japan - DSC06916
self-published workcc-pd-mark
Mirror with lions and grapes, China, Tang dynasty, late 800s AD, bronze - Museu do Oriente - Lisbon, Portugal - DSC06999
closeupcircle
Milarepa, Tibet, c. 18th century AD, firegilt bronze - Linden-Museum - Stuttgart, Germany - DSC03694
self-published workgold
Vessel, prisoner, Moche style, Peru, 100-800 AD, ceramic - Fowler Museum - University of California, Los Angeles - DSC02392
self-published workcc-pd-mark
Vessel with Battle Scene, 600-900 AD, Mesoamerica, Guatemala, Nebaj region, Maya, ceramic and slip, view 1 - Cleveland Museum of Art - DSC08798
files uploaded by daderotcc-zero
Zeus, Roman period, c. 2nd century AD, marble - Matsuoka Museum of Art - Tokyo, Japan - DSC07200
self-published workcc-pd-mark
Dish, Fez, Morocco, 19th century AD, glazed ceramic - Cinquantenaire Museum - Brussels, Belgium - DSC09094
self-published workcircle
Yidam Samvara, western Tibet, 13th-14th century AD, bronze - Linden-Museum - Stuttgart, Germany - DSC03667
self-published workgold
Plate, Fez, Morocco, 19th century AD, glazed ceramic - Cinquantenaire Museum - Brussels, Belgium - DSC09092
self-published workcircle
Scheiben fibula, Balingen, Zollernalbkreis, 7th century AD - Landesmuseum Württemberg - Stuttgart, Germany - DSC02936
circlemacro
Satyr mask, S 716, Roman, 50-100 AD, marble - Musei Capitolini - Rome, Italy - DSC06065
self-published workcc-pd-mark
Pendants with phoenixes and clouds, China, Qianlong period, 1736-1795 AD, silk, metallic threads - Peabody Essex Museum - DSC08030
self-published workcc-pd-mark
Panther and bird, Hai Ba Trung Temple, Vinh Phuc province, 17th century AD, wood - Vietnam National Museum of Fine Arts - Hanoi, Vietnam - DSC05003
self-published workcc-zero
Sho (wind instrument), Japan, 1800s AD, wood, lacquer, bamboo, silver - Peabody Essex Museum - DSC07499
self-published workcc-pd-mark
Saint Anna, Southern Germany, c. 1660 AD, linden wood - Hessisches Landesmuseum Darmstadt - Darmstadt, Germany - DSC00024
self-published workcc-pd-mark
Shiva, India, Tamil Nadu, 1400s AD, bronze - Arthur M. Sackler Gallery - DSC05260
self-published workshiva in sculpture
Shiva and Uma (Somaskanda), India, Tamil Nadue, 1100s AD, bronze - Arthur M. Sackler Gallery - DSC05286
self-published workcc-pd-mark
Sarcophagus with erotes and lions, S 1212, Roman, 3rd century AD, marble - Musei Capitolini - Rome, Italy - DSC05925
self-published workcc-pd-mark
Stele of Jambhala, Eastern India, 700s-1200s AD, stone - Dallas Museum of Art - DSC05020
self-published workcc-pd-mark
Tomb 142, woman with funerary items, mid 6th century AD - Cinquantenaire Museum - Brussels, Belgium - DSC08746
self-published workcc-pd-mark
The Esoteric Buddhist king of passion Ragaraja (Aizen Myoo), Japan, Edo period, 1600-1700 AD, gilding and colors on wood - Asian Art Museum of San Francisco - DSC01516
self-published workaizen myō-ō
Three bowls, Iran, Sasanian dynasty, about 6th century AD, silver - Huntington Museum of Art - DSC05031
self-published workcc-zero
Radish, China, Qing dynasty, 1644-1911 AD, ivory - Sichuan Provincial Museum - Chengdu, China - DSC04649
self-published workcc-pd-mark
Rose water sprinkler, Iran, 10th century AD, glass - Aga Khan Museum - Toronto, Canada - DSC06401
self-published workcc-pd-mark
Tunic, Braunschweig Railroad and Postal Service, c. 1850 AD, wool, brass - Braunschweigisches Landesmuseum - DSC04804
self-published workcc-pd-mark
Tretkurbelrad, Braunschweig, 1868 AD, wood and iron - Braunschweigisches Landesmuseum - DSC04808
self-published workvehicle
Tripod dish, Iran, Seljuk period, late 12th or early 13th century AD, silver with gilt, engraving, and niello - Cincinnati Art Museum - DSC04010
12th-century works in iranself-published work
Tripod dish with horsemen, Mina'i ware,Central Iran, Seljuk period, late 12th or early 13th century AD, earthenware with polychrome enamels and gold over turquoise glaze and colors - Cincinnati Art Museum - DSC04008
self-published workcc-zero
Tray with design of dragons in clouds, Ryukyu Islands, 18th century AD, black lacquer with mother-of-pearl inlay on wood - Ethnological Museum, Berlin - DSC02086
flying dragonblue
Vajrayogini, Tibet, 1644-1911 AD, gilt copper - Sichuan Provincial Museum - Chengdu, China - DSC04347
self-published workyellow
Vishnu, central India, 7th-8th century AD, sandstone - Linden-Museum - Stuttgart, Germany - DSC03840
self-published workcc-pd-mark
Virgin and Child between two candelabra, Padua, 1450-1500 AD, bronze - Bode-Museum- DSC02442
self-published workgold
Ribbed bowl, Syrian, 1-150 AD, mold-pressed glass - Portland Art Museum - Portland, Oregon - DSC09002
self-published workcc-pd-mark
VW Kever brandweer pic3
vehiclecar
Buddha, China, Ming dynasty, 16th-17th century AD, ivory - Royal Ontario Museum - DSC03746
17th-century asian ivoryself-published work
Douglas A-1H Skyraider of VA-52 is readied for launching aboard USS Ticonderoga (CVA-14), dirca in 1967
militaryvehicle
Douglas A-1H Skyraider of VA-65 lands on USS Enterprise (CVAN-65), in 1964
militaryvehicle
US Navy 060105-A-3283V-012 U.S. Navy Lt. Robert Marsh and Boatswain's Mate 1st Class Bill Davison prepare for a test detonation at a range in Ad Diwaniyah, Iraq
explosive ordnance disposal mobile unit 11boatswain's mate (united states navy)
U.S. Navy pilots of Attack Squadron 25 (VA-25) aboard USS Coral Sea (CVA-43), circa in 1968
vietnam war in 1968swords
Amitayus Buddha, Tibet, 1644-1911 AD, gilt copper - Sichuan Provincial Museum - Chengdu, China - DSC04341
self-published workcc-pd-mark
Bügel fibula, Tabingen, Zollernalbkreis, late 6th century AD - Landesmuseum Württemberg - Stuttgart, Germany - DSC02951
self-published workmetal
Arch section with acanthus scroll, fruit and tendrils, Egypt, early 5th century AD, limestone - Sackler Museum - Harvard University - DSC01665
self-published workcc-pd-mark
Bhairava, Indonesia, East Java, 1200s-1400s AD, andesite - Arthur M. Sackler Gallery - DSC05242
self-published workbhairava
Beaker, Iran, 9th to 10th century AD, moulded glass - Aga Khan Museum - Toronto, Canada - DSC06419
self-published workcc-pd-mark
Brush holder, China, Qing dynasty, 1644-1911 AD, ivory - Sichuan Provincial Museum - Chengdu, China - DSC04643
self-published workcc-pd-mark
Brush holder, China, Ming dynasty, 1368-1644 AD, ivory - Sichuan Provincial Museum - Chengdu, China - DSC04632
self-published workcc-pd-mark
Brush holder in the shape of a pine trunk, China, Ching dynasty, 1700s AD, bamboo - Östasiatiska museet, Stockholm - DSC09526
self-published workbrush holders
Box, Spain, 16th century AD, wood, bone, mother-of-pearl - Aga Khan Museum - Toronto, Canada - DSC06588
self-published workcc-pd-mark
Child-saint Sambandar, Chola dynasty, 12th century AD, Tamil Nadu, India, bronze - Freer Gallery of Art - DSC04505
self-published workcc-pd-mark
Child-saint Sambandar, Chola dynasty, 12th century AD, Tamil Nadu, India, bronze - Freer Gallery of Art - DSC04503
self-published workcc-pd-mark
Child's shoes, China, Shanghai, Qing dynasty, 1800s AD - Östasiatiska museet, Stockholm - DSC09539
art of china in östasiatiska museetself-published work
Bodhidharma by Unkei Ikkei, Japan, 1504-1520 AD, ink on paper - Linden-Museum - Stuttgart, Germany - DSC03629
self-published workdaruma
Bottles, perfume flasks, etc, Roman 1st-4th century AD, except for the small, possibly Greek alabastron 5th-4th century BC, glass - Spurlock Museum, UIUC - DSC05896
ancient roman glassware in the spurlock museumself-published work
Bodhidharma by Unkei Ikkei, Japan, 1504-1520 AD, ink on paper, detail - Linden-Museum - Stuttgart, Germany - DSC03631
self-published workdaruma
Ceremonial comb, Umayyad, 7th-8th century AD, ivory - Museum Schnütgen - Cologne, Germany - DSC00203
self-published workcc-pd-mark
1959_International_S172_pic2
1959 international trucksvehicle
Goddess, Cambodia, Angkor period, 10th century AD, bronze - Rautenstrauch-Joest-Museum - DSC00255
self-published workcc-pd-mark
Guhyasamaja, Tibet, 1368-1644 AD, gilt copper - Sichuan Provincial Museum - Chengdu, China - DSC04377
self-published workgold
Covered bowl, Jingdezhen, China, 1625-1650 AD, porcelain - Peabody Essex Museum - Salem, MA - DSC05146
self-published workcc-pd-mark
Covered vase, Arita ware, Japan, c. 1700 AD, porcelain - Peabody Essex Museum - DSC07716
self-published workcc-pd-mark
Cylinder Vase, 600-700 AD, Maya culture, central Peten lowlands, Guatemala, earthenware with polychrome slip - Gardiner Museum, Toronto - DSC01171
7th-century pottery in canada8th-century pottery in canada
Daimyo ship, 1 of 5, 1683 AD - Edo-Tokyo Museum - Sumida, Tokyo, Japan - DSC06611
self-published workcc-pd-mark
Chariot attachment, Roman, 2nd-4th century AD, bronze - Wadsworth Atheneum - Hartford, CT - DSC05141
self-published workcc-pd-mark
Chair, Japan, 1730-1780 AD, lacquered wood - Peabody Essex Museum - DSC07788
self-published workcc-pd-mark
Basin, Syria, c. 1240 AD, brass inlaid with silver, detail - Freer Gallery of Art - DSC04706
self-published workcc-pd-mark
Base of a funerary couch (shichuang) with Sogdian scenes, view 6, Henan province, probably Ce xian, China, Period of Division, Northern Qi dynasty, 550-577 AD, marble with pigment - Freer Gallery of Art - DSC05630
self-published workcc-zero
Ewer, Ly-Tran dynasty, 11th-14th century AD, brown and celadon glazed ceramic - National Museum of Vietnamese History - Hanoi, Vietnam - DSC05514
self-published workcc-zero
Earring, Korea, Three Kingdoms period (Silla), 500s AD - Tokyo National Museum - Tokyo, Japan - DSC08126
self-published workgold
Empress Xiaoke's seal box, China, 1922 AD, gold alloy - Peabody Essex Museum - DSC07912
self-published workcc-pd-mark
Emperor Claudius, inv. 2287, Roman, from Priversno, 41-54 AD - Braccio Nuovo, Museo Chiaramonti - Vatican Museums - DSC00952
self-published workcc-pd-mark
Epigraphic frieze, fragment, Egypt, 10th century AD, carved wood - Aga Khan Museum - Toronto, Canada - DSC06448
self-published workcc-pd-mark
Entrance gate to graveyard of Zu Dashou and sons, view 5, China, Yongtai Village near Beijing, Qing dynasty, 1656 AD, limestone with reconstructed roof - Royal Ontario Museum - DSC03731
self-published workcc-zero
Entrance gate to graveyard of Zu Dashou and sons, view 2, China, Yongtai Village near Beijing, Qing dynasty, 1656 AD, limestone with reconstructed roof - Royal Ontario Museum - DSC03723
self-published workcc-zero
Entrance gate to graveyard of Zu Dashou and sons, view 4, China, Yongtai Village near Beijing, Qing dynasty, 1656 AD, limestone with reconstructed roof - Royal Ontario Museum - DSC03728
self-published workcc-zero
Flute players, Jingdezhen, China, 1730-1750 AD, porcelain - Peabody Essex Museum - Salem, MA - DSC05173
self-published workcc-pd-mark
Earrings, Korea, Three Kingdoms period (Gaya), 500s AD - Tokyo National Museum - Tokyo, Japan - DSC08122
self-published workgold
Fairy riding on a dragon, Loc Du Communale house, Ha Tay province, 17th century AD, wood - Vietnam National Museum of Fine Arts - Hanoi, Vietnam - DSC04920
self-published workcc-zero
Feather tunic, Peru, South Coast, Wari or later, 8th-16th century AD, feathers and cotton - De Young Museum - DSC00312
yellowcolor
Bowl with bird, Egypt, Fatimid period, 11th century AD, earthenware with overglaze luster painting - Cincinnati Art Museum - DSC04165
self-published workbirds of art
Bowl with bird and stylized calligraphy, Iran, Nishapur, 10th-12th century AD, earthenware - Huntington Museum of Art - DSC04978
self-published workbowl
Bowl with horsemen, Mina'i ware,Central Iran, Seljuk period, late 12th or early 13th century AD, earthenware with polychrome enamels and gold over a white glaze and colors - Cincinnati Art Museum - DSC04005
self-published workbowl
3601 - 3700 of 8,588 Next page
/ 86