8,803 Free Images of Six

vehiclecc-zeroshipboatnavyseawateraircraftwarships at naval station norfolkvessel
Last six car H-Toku
vehiclecar
Kiyohara no Motosuke from the Thirty-six Immortal Poets, Nobufusa Version, Kamakura period, 14th century, detached segment, color on paper - Tokyo National Museum - DSC05814 (cropped)
self-published workextracted images
Saale unstrut vineyard landscape
landscapegrass
US Navy 051222-N-0879R-001 A chief petty officer embraces a family member after the nuclear-powered attack submarine USS Pasadena (SSN 752) returned from a six-month deployment
hugging people in the united statescouples in the united states
US Navy 050429-N-3019M-001 Chief Hospital Corpsman Perry Camagong, assigned to Navy Environmental and Preventive Medicine Unit Six (NEMPU-6), Pearl Harbor puts leaves into a trash bag
united states navy images from pearl harborpeople at pearl harbor
US Navy 070131-N-8544C-016 Sailors man the rails aboard guided missile frigate USS Boone (FFG 28) as she pulls into homeport after completing a six-month deployment
manning the rail in the united states navypeople at naval station mayport
US Navy 101116-N-4047W-005 The Los Angeles-class attack submarine USS San Francisco (SSN 711) departs for its six-month western Pacific Ocean
waterboat
US Navy 100421-N-9301W-336 Sailors man the rails as the guided-missile frigate USS Klakring (FFG 42) arrives at Fortaleza, Brazil for a port visit. Klakring is on a six-month deployment to Latin America and the Caribbean as par
manning the rail in the united states navyaboard uss klakring (ffg-42)
US Navy 100501-N-4267W-039 Sailors assigned to Riverine Squadron (RIVRON) 1 load equipment before departing to the Naval Station Norfolk air terminal where they will be flown to Iraq for a six-month deployment
united states navy images from virginia beachvirginia
Fitness power sport
malebody
FAP 2640 heavy duty truck three-axle. side view. Spielvogel 2012
self-published workvehicle
US Navy 090304-N-6597H-035 The Nimitz-class aircraft carrier USS John C. Stennis (CVN 74) transits the Pacific Ocean. John C. Stennis is on a scheduled six-month deployment to the western Pacific Ocean
vehiclesea
US Navy 050131-N-6074Y-158 Marines assigned to the Flying Tigers of Marine Medium Helicopter Squadron Two Six Two (HMM-262), move boxes of food out of the back of a CH-46E Sea Knight helicopter
indian oceanpeople
US Navy 060812-N-4856C-189 A MH-60S Seahawk assigned to Helicopter Combat Support Two Six (HSC-26) takes off from the flight deck
vehiclenavy
US Navy 030826-N-4374S-005 Search and Rescue swimmers assigned to the Chargers of Helicopter Combat Support Squadron Six (HC-6) stand ready aboard an MH-60S Knighthawk
helicopter combat support squadron 6 (united states navy)united states navy images from the atlantic ocean
US Navy 031017-N-1577S-003 An SH-60F Seahawk assigned to the Indians of Helicopter Anti-Submarine Squadron Six (HS-6) recover Search and Rescue (SAR) swimmers
militaryaircraft
US Navy 070703-N-0841E-002 Sailors and Marines assigned to amphibious assault ship USS Bataan (LHD 5) return to Naval Station Norfolk after completing a scheduled six-month deployment
vehicleship
US Navy 081005-N-1522S-004 Friends and family cheer as Sailors aboard the guided-missile frigate USS McInerney (FFG 8) return to homeport at Naval Station Mayport after a six-month deployment
celebritiespeople
US Navy 071216-N-8132M-070 Friends and family of crew members attached to the nuclear-powered aircraft carrier USS Enterprise (CVN 65) hold up signs to welcome Sailors home after a six-month deployment
people at naval station mayportpeople
Wappen Kehrsatz
1 six rays or in heraldryself-published work
US Navy 050914-N-9866B-016 A U.S. Marine Corps UH1-N Huey helicopter, assigned to Marine Light Attack Helicopter Squadron Two Six Seven (HMLA-267), lands on the flight deck of the amphibious assault ship USS Peleliu (LHA 5)
aboard uss peleliu (lha-5)
US Navy 031023-N-2385R-006 An HH-60H Seahawk assigned to the Indians of Helicopter Antisubmarine Warfare Squadron Six (HS-6) transports ordnance from USS Nimitz's (CVN 68) to USNS Kilauea (T-AE 26)
aboard uss nimitz (cvn-68)hh-60h rescue hawk
US Navy 090407-N-6538W-074 Sailors on flight deck of the aircraft carrier USS John C. Stennis (CVN 74) prepare for evening flight operations. John C. Stennis is on a scheduled six-month deployment to the western Pacific Ocean
aboard uss john c. stennis (cvn-74)clouds
US Navy 081016-N-5617R-003 The Los Angeles-class fast attack submarine USS Hampton (SSN 767) departs Naval Base Point Loma on a six-month deployment to the western Pacific Ocean
watership
US Navy 090110-N-8467N-003 The fast-attack submarine USS Alexandria (SSN 757) pulls into Submarine Base New London after completing a scheduled six-month deployment in the U.S. Central Command area of responsibility
warships at naval submarine base new londonuss alexandria (ssn-757)
US Navy 070801-N-4014G-044 A Sailor assigned to guided missile destroyer USS Porter (DDG 78) kisses his spouse good-bye prior to boarding Porter to depart for a six-month deployment
aboard uss porter (ddg-78)naval station norfolk
US Navy 110722-N-DI719-019 The destroyer USS Stockdale (DDG 106) returns to San Diego after a six-month deployment to the Western Pacific and U.S
boatsea
Kiyohara no Motosuke from the Thirty-six Immortal Poets, Nobufusa Version, Kamakura period, 14th century, detached segment, color on paper - Tokyo National Museum - DSC05814
images with extracted imagesself-published work
Nature red blood
butterflynature
Urn with Egyptian figures, part of a six-piece tea and coffee service, J. E. Caldwell & Company, Philadelphia, c. 1875, silver and ivory - Brooklyn Museum - DSC09167
self-published work1870s works
Volvo FE 6x2 waste collector haller. Model 2012. Spielvogel
vehiclecar
Six Thundertigers AT-3 Arrow Formation Flight over Hualien AFB 20160813h
aircraftvehicle
Six Thundertigers AT-3 Arrow Formation Flight over Hualien AFB 20160813g
aircraftvehicle
Roger's Six-photo Sequence at Siskiyou Summit Tunnel (33053612811)
wintersnow
Bentley Le Mans Special english licence registration AL 51 03 pic8
bentley speed six in competitionvehicle
US Navy 030116-F-3488S-008 Two UH-46 Sea Knights and one UH-60 Black Hawk fly toward Guam as a part of a six-helicopter formation during flight training
aircraftvehicle
US Navy 070703-N-5330L-021 A young boy waits for his grandfather to arrive aboard guided-missile destroyer USS Nitze (DDG 94) as ships of Bataan expeditionary Strike Group (ESG) returned home after their six-month deployment
aboard uss nitze (ddg-94)naval station norfolk
US Navy 050513-N-2820Z-002 Rear Adm. Mark W. Kenny watches as Capt. Robert M. Hennegan, left, relieves Capt. Bruce W. Grooms, right, as commander Submarine Squadron Six
celebritiespeople
US Navy 030814-D-9880W-316 Rear Adm. John Butler responds to a technical question from a reporter during a Pentagon press briefing on the details of a newly signed contract to acquire six Virginia Class submarines
pentagon press briefing roomjr
US Navy 100531-N-8273J-532 Chief of Naval Operations (CNO) Adm. Gary Roughead rides with more than 200 injured veterans and supporters in the first 50 miles of the six-day, 350-mile
vehiclesport
US Navy 061120-N-1328C-108 Lt. Cmdr. Wendy Halsey from Honolulu, Hawaii, kicks a soccer ball around like she has since she was six years old
united states navy images from djibouti regionbalbala
Business businessman classroom
illustrationbusiness
Fitness muscle body
healthbody
Vanda tricolor. Houtte, L. van, Flore des serres et des jardin de l’Europe, vol. 6 (1850-1851)
illustrationplants
Red Swamp Banksia. Banksia occidentalis. Houtte, L. van, Flore des serres et des jardin de l’Europe, vol. 6 (1850-1851)
illustrationflower
US Navy 061215-N-7367K-001 Commander, Naval Mobile Construction Battalion One (NMCB-1), Cmdr. Dean A. Tufts embraces his daughter after returning home from a six-month deployment
monochromepeople
EMPL LF Fire Fighting Vehicle on MAN TGS 26.440. Spielvogel
self-published workvehicle
US Navy 040814-N-8704K-007 Aboard USS John F. Kennedy (CV 67), flight deck personnel prepare to carry one of six Iranian mariners by stretcher from an SH-60F Seahawk belonging to the Red Lions of Helicopter anti-submarine Squad
aboard uss john f. kennedy (cv-67)
US Navy 091204-N-2456S-028 The Ticonderoga-class guided-missile cruiser USS Anzio (CG 68) returns to Naval Station Norfolk after completing a six-month deployment to the 5th and 6th Fleet areas of responsibility
boatsea
US Navy 080628-N-7705S-043 The namesake fast-attack submarine USS Norfolk (SSN 714) returns to Naval Station Norfolk following a six month deployment
waterboat
US Navy 100321-N-3136P-209 Engineman 2nd Class Robert Bender, assigned to Riverine Squadron (RIVRON) 1, mans a .50-caliber automatic machine gun during a six-day field exercise at Ft. Knox, Ky
militaryarmy
US Navy 101210-N-9626Y-052 USS John S. McCain (DDG 56) joins a combined formation of twenty-six Japan Maritime Self-Defense Force (JMSDF) and U.S
boatsea
US Navy 080925-N-3570S-116 Hospital Corpsman 2nd Class Maria Collins-Alcala kisses her six-year old son
female hospital corpsmen of the united states navymilitary people of the united states with children
US Navy 081005-N-1522S-014 Family and friends a sign made from painted pillow cases welcoming Sailors assigned to the guided-missile frigate USS McInerney (FFG 8) home to Naval Station Mayport after a six-month deployment
people at naval station mayportaboard uss mcinerney (ffg-8)
US Navy 081005-N-1522S-015 onar Technician 2nd Class David Boswell is welcomed home by his daughter after his return home aboard the guided-missile frigate USS McInerney (FFG 8) from a six-month deployment
people at naval station mayportaboard uss mcinerney (ffg-8)
US Navy 061026-N-4515N-185 Crew Six of a HC-130H Hercules class aircraft, Coast Guard 1500 (CG 1500), stand in front of their old plane during a vintage award ceremony
aircraftvehicle
Fitness photo natural diet nutrition
naturebody
US Navy 060605-N-5067K-007 The Sailors and Marines aboard the amphibious assault ship USS Essex (LHD 2) watch from the flight deck as aircraft from the Flying Tigers of Marine Medium Helicopter Squadron Two Six Two (HMM-262)
shootsea
US Navy 070918-N-8907D-083 Guided-missile destroyer USS Mitscher (DDG 57) pulls into Naval Station Norfolk after a six-month deployment in support of Partnership of the Americas (POA)
boatship
US Navy 070918-N-8907D-197 Line handlers stand by to receive mooring lines as guided-missile destroyer USS Mitscher (DDG 57) pulls into Naval Station Norfolk after a six-month deployment in support of Partnership of the America
warships at naval station norfolknavy
US Navy 080201-N-1831S-199 A Sailor from the amphibious assault ship USS Kearsarge (LHD 3) embraces her daughter after returning from a six-month deployment as part of the Kearsarge Expeditionary Strike Group (ESG)
celebritiesgroup
US Navy 110705-N-YO394-213 Sailors and Royal Netherlands marines swim two kilometers during a six-kilometer amphibious march along the island of Cu
animalswater
Roger's Six-photo Sequence at Siskiyou Summit Tunnel (33024836872)
wintersnow
US Navy 061021-N-5330L-497 Aviation Electronics Technician 3rd Class Steven Sutton assigned to Helicopter Anti-Submarine Squadron Light Four Six (HSL-46) directs a landing aboard the guided-missile cruiser USS Anzio's (CG 68)
aviation electronics technicianaboard uss anzio (cg-68)
Toiletry set with six pieces, Emil Kellemann, 1914, ivory, silver, amber, crystal glass - Germanisches Nationalmuseum - Nuremberg, Germany - DSC03120
self-published workcc-pd-mark
African Border Tree. Newbouldia laevis, as Spathodea laevis. Houtte, L. van, Flore des serres et des jardin de l’Europe, vol. 6 (1850-1851)
illustrationtree
Six putti playing with the arms of Mars, four holding onto a large lance, one on the left wearing a helmet and a sword belt, holding a shield upright, and one placing a garland of flowers and leaves in a basket at right MET DP832107
artworks with known accession numberartworks without wikidata item
Six terms, four female and two male, with Hercules at far right, plate 1, from Caryatidum -...- sive Athlantidum multiformium ad quemlibet Architecture ordinem Accommodatarum centuria prima -...- MET DP272664
artworks with known accession numberartworks without wikidata item
Digital clock number 6
digitalclock
Numbers
symbolgold
Haulmax-3900-20150830-002
self-published workvehicle
Iville (Eure, Fr) église, statues de six saints
self-published workpages with maps
US Navy 080125-N-1082Z-052 The guided-missile frigate USS Carr (FFG 52) returns to the pier on board Naval Station, Norfolk after a six-month deployment
boatsea
US Navy 030328-N-1810F-017 An EA-6B Prowler assigned to the Gaunlets of Electronic Attack Squadron One Three Six (VAQ-136) prepares to land on the flight deck aboard the aircraft carrier USS Kitty Hawk (CV 63)
grumman ea-6 prowler aircraft carrier landingsaboard uss kitty hawk (cv-63)
US Navy 030424-N-6536T-001 An SH-60 Seahawk assigned to the Screaming Indians of Helicopter Antisubmarine Squadron Six (HS-6
militaryvehicle
US Navy 070703-N-4515N-170 Family and friends of Sailors aboard guided-missile cruiser USS Vella Gulf (CG 72) watch as the ship pulls into port at Naval Station Norfolk after a six-month deployment as part of Bataan Expeditiona
general views of uss vella gulf (cg-72)warships at naval station norfolk
US Navy 070123-N-3729H-131 An F-A-18C Hornet assigned to the Blue Diamonds of Strike Fighter Squadron One Four Six (VFA-146) sits ready to launch as Sailors from air department clear the catapult
strike fighter squadron 146 (united states navy)aboard uss john c. stennis (cvn-74)
US Navy 060829-N-6247M-001 The Nimitz-class aircraft carrier USS Abraham Lincoln (CVN 72) departs Naval Station Everett, to begin a six-months post deployment dry dock maintenance period at Puget Sound Naval Shipyard, near Nava
general views of uss abraham lincoln (cvn-72)ship
US Navy 040902-N-1464F-001 The nuclear powered aircraft carrier USS Enterprise (CVN 65) shown moored at pier six, aboard Naval Station Norfolk
vehicleboat
Six different breeds of guppy. Five are fish shown at the 20th Pramong Nomklao fish show event at the Future Park Rangsit, Thailand, in July 2008, while the orange pintail is my own fish at home. The
animalswater
US Navy 050729-N-3019M-004 Sailors man the rails aboard the guided missile destroyer USS O'Kane (DDG 77) as the ship returns to Pearl Harbor from a six-month deployment
shipnavy
Bentley Le Mans Special english licence registration AL 51 03 pic6
automobilecar
Bentley Le Mans Special english licence registration AL 51 03 pic2
vehiclecar
Daoist Immortals by Ki Baitei (1734-1810), view 2 of 2, Japan, Tokugawa period, late 18th century AD, pair of six-fold screens, ink, colors on gold paper - Ethnological Museum, Berlin - DSC02074
art of japan in the ethnological museum, berlinself-published work
US Navy 040218-N-5319A-006 Aviation Ordnanceman 1st Class Ernest Felder assigned to the Knighthawks of Strike Fighter Squadron One Three Six (VFA-136), keeps a watchful eye on flight deck crew
aboard uss george washington (cvn-73)aviation ordnanceman
US Navy 090526-N-9928E-367 The aircraft carrier USS John C. Stennis (CVN 74) transits the Pacific Ocean to Pearl Harbor, Hawaii as part of a scheduled port visit during a six-month deployment to the western Pacific Ocean
vehicleship
US Navy 100307-N-6604E-009 Sailors assigned the Nimitz-class aircraft carrier USS Dwight D. Eisenhower (CVN 69) conduct a man overboard drill in a rigid-hull inflatable boat. Dwight D. Eisenhower is on a six-month deployment
aboard uss dwight d. eisenhower (cvn-69)man overboard drill
US Navy 050606-N-9866B-039 Sailors man-the-rails as the amphibious dock landing ship USS Duluth (LPD 6) return after a schedule six-month deployment
boatship
US Navy 050606-N-9866B-047 A Sailor assigned to the amphibious dock landing ship USS Duluth (LPD 6) hugs his son after returning from a six-month deployment
celebritiesgroup
US Navy 031111-N-8955H-002 The 7th Fleet amphibious command and control ship USS Blue Ridge (LCC 19) rests at Victor Six pier in Guam during a recent port call
general views of uss blue ridge (lcc-19)front views of naval ships
US Navy 061127-N-7656R-001 The Thanksgiving holiday weekend brought four to six inches of snow to the Pacific Northwest region
wintersnow
US Navy 090110-N-8467N-001 The fast-attack submarine USS Alexandria (SSN 757) pulls into Submarine Base New London after completing a scheduled six-month deployment in the U.S. Central Command area of responsibility
waterboat
US Navy 081005-N-1522S-021 onar Technician 2nd Class Joseph Meadows kisses his daughter after after his return home aboard the guided-missile frigate USS McInerney (FFG 8) from a six-month deployment
military in jacksonvilleflorida
US Navy 061202-N-0890S-037 A crew member assigned to the Helicopter Anti-Submarine Squadron Six (HS-6) inspects an SH-60F Seahawk before flight operations on the flight deck aboard the nuclear-powered aircraft carrier USS Nimit
aboard uss nimitz (cvn-68)helicopter tail rotors
US Navy 100319-N-3136P-127 Hospital Corpsman 2nd Class Rocky Gann assists Gunner's Mate Seaman Rob Lotton, both assigned to Riverine Squadron (RIVRON) 1, assemble an M240 automatic machine gun during a six-day field exercise at
m-240 machine gunfort knox
US Navy 081104-N-5148B-048 Capt. Jon Padfield meets his family on the pier following a six-month deployment
military people of the united states with childrenaboard uss peleliu (lha-5)
US Navy 081104-N-5148B-059 Aviation Boatswain's Mate Airman Darien Matthews meets his son for the first time after returning from a six-month deployment
aboard uss peleliu (lha-5)aviation boatswain's mate
US Navy 030327-N-1810F-011 Airman Rossana Ojeda from Colorado Springs, Colo., assigned to the Gauntlets of Electronic Attack Squadron One Three Six (VAQ-136)
shipnavy
US Navy 080201-N-1831S-167 A Sailor from the amphibious assault ship USS Kearsarge (LHD 3) embraces her mother after returning from a six-month deployment as part of the Kearsarge Expeditionary Strike Group (ESG)
celebritiesgroup
US Navy 040815-N-0000X-001 Sailors from the guided missile cruiser USS Vicksburg (CG 69) position a rigid hull inflatable boat (RHIB) next to an Iranian civil authorities patrol craft, during repatriation of six Iranian mariner
rigid-hulled inflatable boats of us navyvehicle
2501 - 2600 of 8,803 Next page
/ 89