2,355 Free Images of Serpent

serpent mound kentucky usacc-zerocc-pd-markfiles uploaded by daderotsnakeanimalswildlifereptilesauthor died more than 100 years ago public domain imagesnature
Animal nature wildlife
animalsnature
Religion thailand buddhism
architecturefinger
Serpent earrings, Tamil Nadu, India, late 1800s to early 1900s, gold - Freer Gallery of Art - DSC04489
self-published workcc-pd-mark
Serpent-bonanni
wind instrumentalists in artserpents
Wyoming has an unbelievable variety of world class wildlife. From grizzly bears to marmots, golden eagles to cutthroat trout, Wyoming offers something for everyone. BLM lands are vital to big game, up
wildlifeanimals
Lion and Serpent No 3 by Antoine-Louis Barye, c. 1832, bronze - Middlebury College Museum of Art - Middlebury, VT - DSC08149
self-published workcc-pd-mark
Billet head in the shape of a sea serpent, from the schooner Diadem, 1855, carved wood with paint and gilt - Cape Ann Museum - Gloucester, MA - DSC01230
yellowfood
Amphora with handles of knotted serpents, by Silvio Calci da Velletri, 1638, marble - Galleria Borghese - Rome, Italy - DSC04654
self-published workcc-pd-mark
Musée Camille Claudel 08092019 Gabriel Jules Thomas 1893 Homme combattant un serpent 1 7867
1893 statues in franceself-published work
Musée Camille Claudel 08092019 Gabriel Jules Thomas 1893 Homme combattant un serpent 2 7870
1893 statues in franceself-published work
Tripod Vase with figures grasping serpents, 700-800 AD, Maya culture, Ulua-Yojoa region, Honduras, earthenware with polychrome slip - Gardiner Museum, Toronto - DSC01164
9th-century pottery in canadabrown
Pot with painted design of serpents, Nasca, La Libertad region, Peru, ceramic - Meso-American collection - Peabody Museum, Harvard University - DSC05956
self-published workcc-pd-mark
Wiwersheim StCyriaque 75
paintings of the brass serpentgolden painting frames
Thailand reptile animal
animalsicons
Underneath the sharon lewis tour
travelfish
Hair serpent (jadanagam), Tamil Nadu, India, late 1800s to early 1900s, gold, silver, cotton, rubies - Freer Gallery of Art - DSC04483
autumngold
Upright serpent, made by Veuve Rust et Dubois, Lyon, France, c. 1830, maple, brass, view 2 - Casadesus Collection of Historic Musical Instruments - Boston Symphony Orchestra - 20180113 175559
self-published workcc-pd-mark
A Great Blue Heron carrying a garter snake in its mouth getting ready to eat it on the shore of the marsh at Bear River Refuge. Third place winner in Animal Behavior Bear River Refuge Photo Contest 20
animalsbird
Upright serpent, made by Veuve Rust et Dubois, Lyon, France, c. 1830, maple, brass, view 1 - Casadesus Collection of Historic Musical Instruments - Boston Symphony Orchestra - 20180113 175544
self-published workcc-pd-mark
Seljord komm
self-published worksea serpent
Uroboros
circularcircle
Palanquin fitting of a naga (sacred serpent), Cambodia, Khmer empire, Bayon period, late 1100s AD, gilt bronze - Dallas Museum of Art - DSC04973
self-published workcc-pd-mark
Religion thailand thailand temple
statuestravel
SekienAyakashi, Toriyama Sekien, 1781
konjaku hyakki shūiukiyo-e
Lair of the Sea Serpent, Elihu Vedder, circa 1899
american paintings in the metropolitan museum of artrealism,symbolism
Snake
reptilesanimals
Spiritual leaf decoration
ornamentsymbol
Serpent effigy, Hopewell culture, Turner Group, Mound 4, altar, Little Miami Valley, Ohio, 200 BC to 500 AD, mica - Native American collection - Peabody Museum, Harvard University - DSC06095
self-published workcc-pd-mark
Background buddha buddhist
backgroundtravel
Background buddha buddhist
backgroundtravel
1818 SeaSerpent NewEnglandMuseum Sept25 NewEnglandPalladium
new england museum (boston)1818 in boston
The Spring, Eurydice Bitten by a Serpent while Picking Flowers (Eurydice's Death), by Eugene Delacroix, 1856-1863, oil on canvas - Museu de Arte de São Paulo - DSC07389
self-published workcc-pd-mark
SekienNodzuchi, Toriyama Sekien, 1779
konjaku gazu zoku hyakkiukiyo-e
En mocassins (1920) (14747592616), 1920
native american legendsen mocassins (1920)
Wildlife animal nature
animalsnature
Wildlife animal nature
animalsnature
Kampf der untergehenden Götter by F. W. Heine, Friedrich Wilhelm Heine, Published in 1882.
illustrations of odinillustrations of thor
Rousseau - La Charmeuse de serpents, en 1907, RF 1937 7, Henri Rousseau
post-impressionism,primitivism,naïve artla charmeuse de serpents
YamataNoOrochi, Toyohara Chikanobu, circa 1870s
yamata no orochiukiyo-e
Transporting Major Gold Funerary Urn of King Vajiravudh from Wat Phra Chetuphon to the Pra Meru Mas at Sanam Luang, Vajiravudh, 24 March 1926
funeral processions of vajiravudhhoists of serpents
Desert slither tongue
animalsicons
Book cover of Anne Rice's Merrick (French edition)., Henri Rousseau
post-impressionism,primitivism,naïve artla charmeuse de serpents
Très Riches Heures du duc de Berry Folio 25, verso: The Garden of Eden, between 1411 and 1416
très riches heures du duc de berryearly netherlandish painting
Megafauna1, 1658
woodcuts of rhinocerosesgerman renaissance
Immaculate Virgin Victorious over the Serpent of Heresy, Basilio Santa Cruz Pumacallao, from 1670 until 1690
paintings in the museo de arte de limacuzco school
The Snake Charmer., Henri Rousseau, 1907
post-impressionism,primitivism,naïve artla charmeuse de serpents
Sea-serpent
serpentsea
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
Moses and the bronze serpent, Jean-Charles Frontier, 1743
jean-charles frontierreligious art
Pl. 5: A Serpent Attacking Buoso Donata ['...He ey'd the serpent and the serpent him.' Hell; Canto xxv. line 82.], William Blake, 1827
engravings in the yale center for british artromanticism,fairy painting
Victor Florence Pollet - Vénus et le Serpent, Victor Florence Pollet, before 1882
victor florence pollet
The life-history of British serpents and their local distribution in the British Isles (1901) (14783900673), George Edward Lodge, 1901
the life-history of british serpents and their local distribution in the british isles (1901)lagopus lagopus scotica (illustrations)
Hercules wurgt in zijn wieg de twee slangen, RP-P-1903-A-23283, Charles Howard Hodges, 1793
mezzotints in the rijksmuseum amsterdamprints by charles howard hodges
Serpent wall
texturescraft
The Hundred Bibliophiles, Brittany offering the Black Serpent to this Society, Malo-Renault, circa 1913
works fine arts by émile malo-renault1910s etchings
Serpent Mound crater 1974 1VDHV00040075
historicalhistory
Mars - The Serpent Dust Devil of Mars
goldenbrown
Serpent Ananta Shesha
Serpent
burning man
n272_w1150
anatomysnake
n270_w1150
anatomysnake
Vishnu Laxmi and Serpent Anant, Raja Ravi Varma
lithograph or oleograph prints by raja ravi varma presspadmanabha
Three Deer & The Serpent
animalsdeer
Cat Killing a Serpent, Sennedjem
charles k. wilkinsontomb of sennedjem
Dunster eglise thornhill serpent, James Thornhill
james thornhillbaroque
Serpent-Auréole, Odilon Redon, 1890
lithographs in the british museumsymbolism
Apollo Winner of the Serpent Python, Pietro Benvenuti, circa 1813
1813 paintings from italypietro benvenuti
Pl. 4: The Six-Footed Serpent Attacking Agnolo Brunelleschi ['...lo! a serpent with six feet/ Springs forth on one,'Hell; Canto xxv. line 45.], William Blake, 1827
engravings in the yale center for british artromanticism,fairy painting
Snake of wisdom by Roerich (1924), Nicholas Roerich, 1924
thumbnails of paintings by nicholas roerichludovisi throne
Georges-Antoine Rochegrosse & Eugène-André Champollion - Salammbô - Le serpent, 1900
georges-antoine rochegrossesymbolism,orientalism
Le Serpent noir, Malo-Renault
illustrations by émile malo-renaultbooks by paul adam
20171025_103006
serpent mound kentucky usa
20171025_104534
serpent mound kentucky usa
20171025_103252
serpent mound kentucky usa
20171025_103519
serpent mound kentucky usa
20171025_102640
serpent mound kentucky usa
20171025_103604
serpent mound kentucky usa
1101 - 1200 of 2,355 Next page
/ 24