174,425 Free Images of P

cc-zerovehiclep as an initialplantsaircraftmilitarywizerunki książąt i królów polskichflightaviationfly
Captain Robert Knox (1642-1720), by P Trampon
robert knoxp. trampon
Portrait of Thomas P. Emigh, by William A. Coulter
william alexander coulter1901
Ratskay - Nanebovzatie P. Márie - P. Mária Immaculata - O 461 - Orava Gallery
paintings in the orava gallery
Inicjał P (Wizerunki książąt i królów polskich)
wizerunki książąt i królów polskichp as an initial
Koning, P
de militaire willems-orde (p. h. k. van schendel)military people of the netherlands
Charles P. Chouteau 02
charles p. chouteau (ship1877
Wenceslas Hollar - P
university of toronto wenceslas hollar digital collectionp as an initial
Luca Pacioli, De divina proportione, Letter P
font design by luca pacioliblack letter p
T. Roosevelt - P. Raymond Audibert, Paris. LCCN2012645520 (cropped)
portraits of theodore rooseveltp. raymond audibert
Wenceslas Hollar - P 2
university of toronto wenceslas hollar digital collectionp as an initial
Commedia(Inferno) Lana, capolettera 'P' pag131.
illustrations to the divine comedyp as an initial
Thomas P. Way (steamboat) Bard painting
1850s paintings by james bard1859
Inicjał P 5 (Wizerunki książąt i królów polskich)
wizerunki książąt i królów polskichp as an initial
Inicjał P 6 (Wizerunki książąt i królów polskich)
wizerunki książąt i królów polskichp as an initial
Inicjał P 3 (Wizerunki książąt i królów polskich)
wizerunki książąt i królów polskichp as an initial
Inicjał P 7 (Wizerunki książąt i królów polskich)
wizerunki książąt i królów polskichp as an initial
Inicjał P 8 (Wizerunki książąt i królów polskich)
wizerunki książąt i królów polskichp as an initial
Inicjał P 4 (Wizerunki książąt i królów polskich)
wizerunki książąt i królów polskichp as an initial
US Navy 041113-N-0331L-010 Ens. Eduardo Sanchez from Argentine ship ARA Spiro (P 43), fires a .50 caliber machine gun aboard the Oliver Hazard Perry class frigate USS Dewert (FFG 45) as part of a gunnery exercise during UNITAS
muzzle flashes of firearmssea
J. P. Rizal Extension, District II, Makati City 14°33'46"N 121°3'34"E J. P. Rizal Street 14°34'18"N 121°0'57"E District II, List of barangays of Metro Manila, Legislative districts of Makati, Baranga
shoppingfood
Initial P- Saint Paul; Initial P- A Bishop Giving a Letter to a Messenger - Google Art Project
p as an initial in illuminated manuscriptsminiatures of saint paul
Personenzuglok the long-running tender p8
vehicletoy
J-52-P-408 Turboject, Pratt & Whitney - Oregon Air and Space Museum - Eugene, Oregon - DSC09716
aircraft engines in the oregon air and space museumself-published work
US Navy 110826-N-AW342-163 Rear Adm. Richard Breckenridge, commander of Carrier Strike Group (CSG) 2, is rendered honors
people at naval submarine base new londoncelebrities
US Navy 110825-N-ZI300-002 Sailors aboard the guided-missile frigate USS Thach (FFG 43) prepare to arrive in Panama City, Panama for the close of P
boatsea
US Navy 120113-N-AW342-005 Capt. Michael Holland, commodore of Submarine Squadron (SUBRON) 2, speaks to Sailors assigned to the Los Angeles-class a
michael p. hollandpeople
US Navy 111214-N-DR144-047 Aircrew Survival Equipmentman 3rd Class Haley Craft deflates air bladders for LPU-34B-P low-profile floatation collars i
aboard uss carl vinson (cvn-70)bladder
US Navy 110606-N-NY820-130 Hospital Corpsman 2nd Class Antonio Carranza, from Santa Ana, Calif., conducts a subject matter expert exchange on CPR p
peoplegroup
US Navy 110407-N-DR144-338 Aviation Support Equipment Technician Airman Scott Jensen secures panels after adjusting the fuel injectors on a P-25 fi
aboard uss carl vinson (cvn-70)p25 fire engine
Metz Le Met' Van Hool Exquicity 24 n°1320 MA P+R Rochambeau (4)
self-published workvehicle
Messerschmitt ME 1101
militaryvehicle
Nissan SKYLINE 350GT FOUR HYBRID Type P (V37) rear
vehiclecar
Lockheed - Mitsubishi F-104J Starfighter - Eikō ‘515 - 36-8515 - A-P-W’ (28315028848)
militaryvehicle
US Navy 100108-N-5423C-052 Cmdr. Jessica M. Pfefferkorn, commanding officer of Naval Support Activity Panama City and Cmdr. Timothy P. Richardt, commanding officer
naval support activity panama citygarry c. dean
P-34 was found lying on this trail by a hiker in Point Mugu State Park on September 30. Preliminary results from the necropsy indicate she may have died as a result of rodenticide poisoning. Courtesy
animalsmammals
Image title: White fish humpback fishes Image from Public domain images website, http://www.public-domain-image.com/full-image/fauna-animals-public-domain-images-pictures/fishes-public-domain-images-p
coregonus pidschian
IdentificatieTitel(s): Bacchus vindt Ariadne op NaxosObjecttype: prent Objectnummer: RP-P-1880-A-4199Catalogusreferentie: Hollstein Dutch 47-3(3)Opschriften / Merken: verzamelaarsmerk, verso linksonde
prints by moyses van wtenbrouck in the rijksmuseum amsterdamdionysos and ariadne
IdentificatieTitel(s): AriadneVrouwen uit de klassieke mythologie (serietitel)Objecttype: prent Serienummer: 3/6Objectnummer: RP-P-OB-54.336Catalogusreferentie: Hollstein German 43Opschriften / Merken
german prints in the rijksmuseum amsterdamnikolaus solis
IdentificatieTitel(s): Ariadne zittend op een panter; vooraanzichtAanzichten van het beeld van Heinrich von Dannecker van Ariadne op de panter (serietitel) Objecttype: prent Objectnummer: RP-P-2013-24
uncategorized images of the rijksmuseum
J. P. Rizal Extension, District II, Makati City 14°33'46"N 121°3'34"E J. P. Rizal Street 14°34'18"N 121°0'57"E District II, List of barangays of Metro Manila, Legislative districts of Makati, Baranga
peopleplants
J. P. Rizal Extension, District II, Makati City 14°33'46"N 121°3'34"E J. P. Rizal Street 14°34'18"N 121°0'57"E District II, List of barangays of Metro Manila, Legislative districts of Makati, Baranga
convolvulaceaeplants
Oldtimer model buses transport and traffic
trafficmodel
Rocks stones rounded
landscapescenes
The tire wheel of Nissan SKYLINE 350GT HYBRID Type P (V37)
vehiclecar
P-51 Mustang Alliance Air Show 06
aircraftvehicle
Curtiss-Wright P-47G-10-CU - TP-47G-CU Thunderbolt 'WZ-D - 225068' (G-CDVX) (26024429021)
militaryvehicle
Seulberger Mark, Grenzstein GI OE, HH SR P (2), Petterweiler Seite
leavesrock
Hippo n Baby P Zoo
self-published workpd us no notice
Nissan SKYLINE 350GT HYBRID Type P (HV37) front
vehiclecar
7th Fleet Vice Adm. Aucoin transits to USS Ronald Reagan 151124-N-EI558-017
people at naval air facility atsugiuss ronald reagan (cvn-76)
US Navy 010304-A-0000J-002 Christening of the Ronald Reagan CVN 76
christening of uss ronald reagan (cvn-76)george w. bush in march 2001
US Navy 060217-N-8726C-006 A Sailor assigned to the Tridents of Patrol Squadron Two Six (VP-26), makes last minute adjustments to equipment prior to the launch of a P-3 Orion
naval air station sigonella in the 2000sdark
US Navy 110526-N-PO203-066 Rear Adm. Nevin P. Carr, Chief of Naval Research, speaks with research managers about the Railgun on display at Pier 88
militarynavy
US Navy 110713-N-YR391-049 A Sailor aboard the aircraft carrier USS Enterprise (CVN 65) observes from the forecastle as Enterprise approaches the p
stockless anchormetal
US Navy 110514-N-OS574-168 Sailors and Marines from the San Antonio-class amphibious transport dock ship USS Mesa Verde (LPD 19) p
boatsea
US Navy 051221-N-9866B-625 U.S. Naval Academy Superintendent Vice Adm. Rodney Rempt cheers at a pep rally
aboard uss peleliu (lha-5)group
US Navy 101028-N-8623S-019 Naval Air Crewman (Mechanical) 2nd Class J.J. Schumacher, a P-3 Orion assistant flight engineer assigned to Patrol Squad
united states navy images from misawaflight engineer
160311-N-QF605-014 (25582344552)
vessels of the united states sixth fleetusns spearhead (t-epf 1)
Leonotis leonurus (L.) R.Br., Monk's Cowl area, Natal Drakensberg, South Africa
natureplants
Mäuse-Gerste (Hordeum murinum) an einer Ruderalstelle in der Berlinallee in Hockenheim
poaceaeplants
William Pennington and Petr Pavel 170725-N-SO730-020 (36213549051)
bridge of the uss george h. w. bush (cvn-77)william p. pennington
IdentificatieTitel(s): Bacchus vindt Adriadne op NaxosObjecttype: prent Objectnummer: RP-P-OB-24.998Catalogusreferentie: Hollstein Dutch 47-2(3)Opschriften / Merken: verzamelaarsmerk, verso linksonder
prints by moyses van wtenbrouck in the rijksmuseum amsterdamdionysos and ariadne
Image title: Reptile eastern spadefoot toad Image from Public domain images website, http://www.public-domain-image.com/full-image/fauna-animals-public-domain-images-pictures/reptiles-and-amphibians-p
amphibiaanimals
Mrs Caudles Lecture 12 letter P
richard doyle (illustrator)p as an initial
A view of Savanah (sic) as it stood the 29th of March, 1734 - P. Gordon inv. ; P. Fourdrinier sculp. LCCN96514600
savannahgeorgia
A view of Savanah (sic) as it stood the 29th of March, 1734 - P. Gordon inv. ; P. Fourdrinier sculp. LCCN96514600
savannahgeorgia
Mrs Caudles Lecture 15 letter P
richard doyle (illustrator)p as an initial
Pearce Madame P. p.113
list of american painters exhibited at the 1893 world's columbian expositioncharles sprague pearce
Pesellino - The Annunciation (diptych), c.1450–1455, P.1966.GP.313
the annunciation (diptych) (p.1966.gp.313)
Mrs Caudles Lecture 17 letter P
richard doyle (illustrator)p as an initial
Tausendschön monatsroeserl m p
naturespring
The tire wheel of Subaru LEGACY OUTBACK Limited (BS9)
vehiclecar
Nissan SKYLINE 350GT FOUR HYBRID Type P (HV37) front
vehiclecar
P-3C Orion 030314-N-0780F-017
militaryvehicle
Newton maid cottage (Sioux City) from N 1
building structureroof
P-51 Mustang Alliance Air Show 07
militaryvehicle
P-51 Mustang Alliance Air Show 08
aircraftvehicle
Effective conservation of the greater sage-grouse and its habitat requires a collaborative, science-based approach that includes strong federal plans, strong plans for state and private lands, and a p
animalsbird
Effective conservation of the greater sage-grouse and its habitat requires a collaborative, science-based approach that includes strong federal plans, strong plans for state and private lands, and a p
animalsbird
ICONOGRAPHIE ORNITHOLOGIQUE FI. 51. •r Coiiurus acuticauclatiis . ( (i.R. CjràY.) JPERRUCHE -ACUTICAUDE. P-OudaitpinxJetlitb. 0. des Murs, direx^ Imp.Lith. de Becauet.
animalsbird
Mäuse-Gerste (Hordeum murinum) an einer Ruderalstelle in der Berlinallee in Hockenheim
poaceaeplants
Populus tremula (not P. alba as filename states)
plantstree
Бирюлёвский дендропарк. Большая Еловая аллея. 1972-1974 гг. Обоснование точки на https://pastvu.com/p/849518
picea abiesplants
President Richard Nixon and Mrs. Nixon Hosting a White House Dinner Honoring American Labor on Labor Day
monochromepeople
US Navy 081020-N-1635S-003 Capt. John P. Nolan, commanding officer of the Ticonderoga-class guided-missile cruiser USS Chancellorsville (CG 62), observes a replenishment at sea
navigation (underway replenishment)uss chancellorsville (cg-62)
US Navy 101028-N-8623S-041 Lt. Sean O'Neill, tactical coordinator of Patrol Squadron (VP) 9, performs a sonobuoy continuity check during a prefligh
united states navy images from misawap-3 orion interiors
Vice President Michael R. Pence aboard USS Ronald Reagan 15
guests aboard uss ronald reagan (cvn-76)joseph p. aucoin in 2017
US Navy 110726-N-ZZ999-007 Adm. Patrick M. Walsh, commander of U.S. Pacific Fleet, talks with Capt. Jesse A. Wilson, mission commander of Pacific P
peoplejr
US Navy 101007-N-6770T-181 Hospital Corpsman 2nd Class Shawn P. Cairy, a reserve component Sailor, explains medications he is giving to a Filipino
san miguelbulacan
Louis Legendre by Jean-Louis Laneuville (Carnavalet P 2759) 02
louis legendre by jean-louis laneuville (carnavalet p 2759)
Charles P. Chouteau 01
steamboats on the mississippi river1877
Podróż po Warszawie - operetka w 7 obrazach - Tekst p. Feliksa Schobera, muzyka p. Sonnenfelda (72547)
arkadiusz mucharski
Stephen P. Hill, Pastor of the First Baptist Church, Washington, D.C LCCN2003673096
clergy from the united statesstephen p. hill
Henry Clay - A. Gibert del. from a daguerreotype by P. Haas ; lith. and published by P. Haas, Washington City. LCCN2013645246
henry clay
William P. Stubbs (attrib.) - A Four Mast Schooner King Philip
19th-century sailing ships in paintingswilliam p. stubbs
Henry Clay - A. Gibert del. from a daguerreotype by P. Haas ; lith. and published by P. Haas, Washington City. LCCN2013645246
henry clay
Ambona w kościele Opieki Św. Józefa (p. p. wizytek) w Warszawie (58873)
history of visitation order church in warsaw
Submarine Torpedo Boat H.L. Hunley, Dec. 6, 1863, Conrad Wise Chapman, 1864
1864 paintings in the united statesconrad wise chapman
P-51 Mustang Alliance Air Show 03
militaryvehicle
P-51 Mustang Alliance Air Show 12
militaryvehicle
6101 - 6200 of 174,425 Next page
/ 1745