18,962 Free Images of Operation

vehicleaircraftmilitaryshipaviationnavy2011jetoperation tomodachi in marchuss ronald reagan (cvn-76) humanitarian aid
Nuclear depth charge explodes near USS Agerholm (DD-826) on 11 May 1962
depth chargesship
Pc web error
technologycomputer
Piston rod phillips slipway
industrialvehicle
Three juvenile Whooping Cranes (Grus americana) begin to leave a holding pen on Wheeler National Wildlife Refuge, Decatur, Alabama. Photo by Bill Gates, USFWS Feb. 10, 2012
animalsbird
Douglas B-18B (SN 37-530, originally a B-18A) with the MAD tail boom 061128-F-1234S-023
aircraftvehicle
20200116-Wiener-Lokalbahn-118
vehiclewtfpl
US Navy 070413-N-8907D-004 A plane director signals for an F-A-18C Hornet, from the Wildcats of Strike Fighter Squadron (VFA) 131, to go full throttle while a hold back operator runs clear on the flight deck of Nimitz-class air
aircraftaviation
US Navy 071128-N-8273J-008 Chief of Naval Operations (CNO) Adm. Gary Roughead speaks in honor of the Vice Adm. James Bond Stockdale awardees, Cmdrs. Frank J. Olmo and Craig A. Clapperton
gary roughead in 2007craig a. clapperton
US Navy 071127-N-5642P-175 U.S. Marine Corporal Laura Buckingham, assigned of the 22nd Marine Expeditionary Unit (Special Operations Capable), which is embarked aboard USS Kearsarge (LHD 3), sets up a satellite
women in the united states marine corps22nd marine expeditionary unit
US Navy 071207-N-9758L-040 Rear Adm. Doug McClain, director of global operations, United States Strategic Command, talks to a Pearl Harbor survivor prior to a joint U.S. Navy-National Park Service ceremony
united states navy images from pearl harborsurvivors of the pearl harbor attack
US Navy 090112-N-7705S-092 Lt. Cmdr. Brad Terry, left, executive officer of the Los-Angeles class attack submarine USS Boise (SSN 764), presents a plaque with the boat's seal to Republic of Korea Navy Chief of Naval Operations
naval station norfolksubmarine interiors
US Navy 070529-N-0684R-089 British frigate HMS Cornwall (F 99) approaches Nimitz-class aircraft carrier USS John C. Stennis (CVN 74) to provide plane guard support to the carrier during flight operations
vehicleship
US Navy 070604-N-8497H-030 Director of Global Operations (J3) United States Strategic Command, Rear Adm. Doug McClain, talks to (KFOR) Channel Four News's Ali Meyer about the Navy and events during Oklahoma Navy Week
united states navy images from oklahoma citydouglas l. mcclain
US Navy 070720-N-8119R-087 viation Boatswain's Mate (Equipment) Airman Sergio Rojas stands bow safety during flight operations as an EA-6B Prowler, assigned to the Black Ravens of Tactical Electronic Warfare
aviation boatswain's mateequipment
US Navy 070726-N-6278K-024 Capt. Bob Kapcio, mission commander aboard the Military Sealift Command hospital ship USNS Comfort (T-AH 20), speaks to Rear Adm. Palacios, Chief of Naval Operations of the Salvadoran Navy in Acajutla
military of el salvadorpeople
US Navy 070113-N-5345W-080 Air department Sailors wrap, or seal, bow catapult number two at the conclusion of daytime flight operations, aboard the Nimitz-class aircraft carrier USS Harry S. Truman (CVN 75)
peoplewater
US Navy 070112-N-0490C-003 The Ticonderoga-class guided missile cruiser USS Bunker Hill (CG 52) comes alongside of the Nimitz-class aircraft carrier USS Dwight D. Eisenhower (CVN 69) to observe flight operations
boatship
US Navy 110315-N-GL340-059 An HH-60H Sea Hawk helicopter assigned to the Black Knights of Anti-Submarine Squadron (HS) 4 prepares to land aboard th
breakfast cereal2011
US Navy 110318-N-GL340-053 Sailors load food and humanitarian supplies aboard an HH-60H Sea Hawk helicopter assigned to the Black Knights of Helico
military2011
US Navy 110321-N-2653B-153 Sailors aboard the aircraft carrier USS Ronald Reagan (CVN 76) load supplies onto an SH-60F Sea Hawk helicopter from the
militaryaircraft
US Navy 080818-N-8273J-288 Engineman 2nd Class Jerry Valdez has 2nd class petty officer crows pinned on him by Chief of Naval Operations (CNO) Adm. Gary Roughead, right, and his wife and daughter after Valdez is promoted
gary roughead in 2008people
US Navy 090718-N-3610L-263 Lt. Cmdr. James Carver inspects the exterior of an EA-6B Prowler assigned to the Cougars of Tactical Electronic Warfare Squadron (VAQ) 139 before flight operations aboard the aircraft carrier USS Rona
electronic attack squadron 139 (united states navy)grumman ea-6 prowler on flight decks
US Navy 090420-N-1251W-012 Chief of Naval Operations (CNO) Adm. Gary Roughhead speaks with Hospital Corpsman 3rd Class Sean Smith during a visit to guided-missile destroyer USS Fitzgerald (DDG 62)
aboard uss fitzgerald (ddg-62)gary roughead in 2009
US Navy 090420-N-8273J-028 Chief of Naval Operations (CNO) Adm. Gary Roughead speaks with Sailors in the engineering log room aboard the Arleigh Burke-class guided-missile destroyer USS Fitzgerald (DDG 62)
aboard uss fitzgerald (ddg-62)gary roughead in 2009
US Navy 100108-N-8273J-264 Chief of Naval Operations (CNO) Adm. Gary Roughead visits Provincial Reconstruction Team Farah in Afghanistan
united states navy in the war in afghanistan (2001–2014)gary roughead in afghanistan
US Navy 100330-N-7058E-513 USS McInerney (FFG 8) stays in formation with a rigid-hull inflatable boat from the littoral combat ship USS Freedom (LCS 1) during joint counter-illicit trafficking operations in the U.S. 4th Fleet a
boatsea
US Navy 100208-N-7498L-028 The 599th Transportation Group and Fleet Industrial Supply Center Pearl Harbor loaded more than 2,400 pieces of equipment. With more than 300 Stryker vehicles, the operation is the largest Stryker mov
boatsea
US Navy 061122-N-8148A-153 U.S. Navy Aviation Warfare Systems Operators 3rd Class Jonathan DeJesus, left, and Christopher Adams, watch the Military Sealift Command (MSC) fast combat support ship USNS Supply (T-AOE 6)
aboard usns supply (t-aoe-6)mh-60s seahawk
US Navy 061127-N-1713L-040 The guided-missile frigate USS Kauffman (FFG 59) departs Naval Station Norfolk as part of Surface Strike Group (SSG) 07-1 for a six-month deployment in support of Maritime Security Operations
boatship
US Navy 060607-N-2651J-062 Air Warfare System's Operator 2nd Class, Randy Eaton pushes himself out of an MH-60S Seahawk helicopter, assigned to Helicopter Sea Combat Support Squadron Twenty Six (HSC-26) Detachment 4, during sea
helicopter sea combat squadron 26 (united states navy)aboard uss saipan (lha-2)
U.S. Navy Naval Aircrewman (Operator) 2nd Class Clark Urbin, assigned to Patrol Squadron (VP) 16, deploys a Mark 58 marine location marker out of the freefall chute of a P-8A Poseidon aircraft while flying over 140415-N-VD564-033
patrol squadron 16 (united states navy)people
US Navy 051025-N-4374S-003 A Visit, Board, Search, and Seizure (VBSS) team from the guided missile frigate USS Samuel B. Roberts (FFG 58) departs for Maritime Interdiction Operation (MIO) training with the Uruguayan frigate ROU
vehiclewater
F-4N Phantoms of VFMA-323 in flight with CF-5A and CF-5B 1973
militaryvehicle
The aircraft carrier USS Carl Vinson (CVN 70), background, relieves the aircraft carrier USS George H.W. Bush (CVN 77) in the Persian Gulf Oct. 18, 2014, during Inherent Resolve 141018-N-MU440-027
vehicleship
Flame dark love
backgroundchristmas
Drinks beer gastronomy
celebritiesbeer
US Navy 060328-N-6074Y-048 Lt. Greg C. Knutson, a pilot from Helicopter Anti-Submarine Squadron Two (HS-2) Golden Falcons, reviews flight details on an operational map with Lt. Cmdr. Mark Leavitt and air crew
united states navy images from gyeonggi-doosan
US Navy 060421-N-0000T-001 Cmdr. Mike Ginter, Operations Officer aboard USS John F. Kennedy (CV 67), raffled off a ride in his World War II T-6 Texan aircraft
militaryvehicle
US Navy 070508-N-4965F-002 Adm. Robert F. Willard, former Vice Chief of Naval Operations, salutes as he's piped through the sideboys during a change of command ceremony
male military people salutinggroup
US Navy 070517-N-6854D-002 Two hold back operators run clear before an F-A-18C Hornet, from the Rampagers of Strike Fighter Squadron (VFA) 83, launches from Nimitz-class aircraft carrier USS Dwight D. Eisenhower (
aircraftvehicle
US Navy 061203-N-2636M-157 Aviations Warfare Systems Operator 2nd Class Omar Perez Rodriguez from Helicopter Sea Combat Squadron Two Six (HSC-26) inspects a fuel sample from Airman Minh T. Le while refueling an MH-60 during fli
helicopter sea combat squadron 26 (united states navy)aboard uss bataan (lhd-5)
US Navy 070216-N-0696M-062 Chief of Naval Operations (CNO) Adm. Mike Mullen salutes during his arrival at the change of command ceremony for Commander, Naval Air Systems Command at Naval Air Station Paxtuxent River
male military people salutingmichael g. mullen in 2007
US Navy 031003-N-5319A-007 Admiral Vern Clark, Chief of Naval Operations (CNO) congratulates Adm. Robert J. Natter, Commander U.S. Atlantic Fleet, during his Change of Command ceremony
militaryarmy
US Navy 100206-N-2735T-032 Marines from the 22nd Marine Expedition Unit (22nd MEU) carry supplies from an CH-53E Sea Stallion helicopter after arriving at the Civilian Military Operations Center in Carrefour, Haiti
united states navy images from port-au-princehaiti
US Navy 100209-N-2143T-001 Rob Campbell, deputy program director of Navy Region Northwest Port Operations, delivers remarks during the activation ceremony for the new Navy tug boat Valiant (YT 802)
vehiclewater
US Navy 100328-N-5366K-130 Chief Special Warfare Operator (SEAL) Justin Gauny, left, and Aircrew Survival Equipmentman 1st Class Victor Maldonado, assigned to the U.S. Navy parachute demonstration team, the Leap Frogs, prepare
arizonafly
US Navy 100427-N-1675O-245 Seaman Drew Iverson directs an SH-60F Sea Hawk helicopter during flight operations aboard USS Blue Ridge (LCC 19)
militaryaircraft
US Navy 090915-N-3271W-052 Personnel Specialist Seaman Johnell Torres of Navy Operational Support Center Reno reads with a student
men reading booksreading boy
US Navy 080711-N-3659B-244 Aircraft are readied for launch off the bow catapults of the Nimitz-class aircraft carrier USS Ronald Reagan (CVN 76) during night flight operations
f/a-18 hornet on flight decksmilitary activities at night
US Navy 090326-N-5617R-169 Vice Chief of Naval Operations Adm. Patrick Walsh, center right, and distinguished guests cut a ribbon during the grand opening of the Pacific Beacon military housing facility at Naval Base San Diego
patrick m. walshcelebrities
US Navy 090420-N-1251W-014 Chief of Naval Operations (CNO) Adm. Gary Roughhead speaks with a Sailor assigned to the Arleigh Burke-class guided-missile destroyer USS Fitzgerald (DDG 62) during a tour of the ship
aboard uss fitzgerald (ddg-62)gary roughead in 2009
US Navy 090813-N-6233H-089 Lt. Matt Diederich, assigned to the Royal Maces of Strike Fighter Squadron (VFA) 27, explains how an F-A 18C Hornet operates to students from Manila high schools
aircraftvehicle
US Navy 081012-N-3659B-004 An F-A-18C Hornet assigned to the
aircraftfly
US Navy 081018-N-4236E-185 A landing craft air cushion (LCAC) assigned to Assault Craft Unit (ACU) 4 conducts amphibious operations from the multi-purpose amphibious assault ship USS Iwo Jima (LHD 7)
vehicle1992
US Navy 081222-N-0000X-379 Deputy Governor of Khost Province Taiwar Khan Subarai and Gary Roughead discuss the construction of the Provincial Government Center. Chief of Naval Operations
military people and civiliansgary roughead in 2008
US Navy 090731-N-2918M-017 Lt. j.g. David helps San Diego Girl Scouts prepare for Operation Thin Mint as the aircraft carrier USS Nimitz (CVN 68) prepares to depart for a scheduled deployment to the western Pacific Ocean
girl scout cookiecelebrities
US Navy 090615-N-6676S-102 The Military Sealift Command large, medium-speed roll-on-roll-off ship USNS Seay (T-AKR 302) conducts operations supporting Joint Logistics Over-The-Shore (JLOTS) exercises
vehiclewater
US Navy 030527-N-2385R-001 R. Lee Ermey, host of the popular History Channel program Mail Call, observes flight operations aboard USS Nimitz
f/a-18f super hornet on flight decksuss nimitz (cvn-68) flight deck
US Navy 030611-N-4374S-003 Crewmembers assigned to the Aegis-class cruiser USS Vella Gulf (CG 72) conduct a small arms fire exercise during the annual maritime exercise Baltic Operations 2003 (BALTOPS 2003)
militarynavy
US Navy 070724-N-4238B-125 Construction Mechanic 1st Class William Schneider and Equipment Operator 1st Class Manuel Gradillas, attached to Military Sealift Command hospital ship USNS Comfort (T-AH 20), build a door frame at Jo
united states navy images from corintoaboard usns comfort (t-ah-20)
US Navy 070920-N-2984R-001 Chief Master-at-Arms Gabriel Martinez, assigned to Operations department aboard Nimitz-class aircraft carrier USS Harry S. Truman (CVN 75), waits his turn to load and fire a mounted .50-caliber machin
aboard uss harry s. truman (cvn-75)master-at-arms
US Navy 070910-N-7883G-009 Airman Luis Estrada, topside petty officer for the waist catapult aboard USS Kitty Hawk (CV 63), verifies that the holdback bar is in place prior to launch
aviation boatswain's mateequipment
US Navy 080815-N-8273J-518 Chief of Naval Operations (CNO) Adm. Gary Roughead, tours a schoolhouse construction site with members of Provincial Reconstruction Team (PRT) Ghazni
military people and civilianswood
US Navy 080828-N-4005H-032 An F-A-18C Hornet launches from the flight deck of the Nimitz-class aircraft carrier USS Ronald Reagan (CVN 76).
militaryvehicle
US Navy 071130-N-4198C-002 Builder 2nd Class Joseph Milauckas, a Seabee attached to NMCB-3, mans a 240-machine gun on the turret of a mine resistant ambush protected vehicles at Fort Hunter Liggett
fort hunter liggettm-240 machine gun
US Navy 080617-N-3857R-019 Special warfare combatant-craft (SWCC) crewmen assigned to Special Boat Team 22 traverse the waterways of the Stennis Space Center
vehiclewater
US Navy 080620-N-7883G-187 HSC-25 aviation warfare systems operators watch as Aviation Ordnanceman Airman Robert Campbell, right, and Aviation Ordnanceman Airman Abby Blair attach a cargo pennant to an MH-60S Seahawk on the fli
aboard uss kitty hawk (cv-63)aviation ordnanceman
US Navy 110315-N-5503T-577 HH-60H Sea Hawk helicopters from the Black Knights of Helicopter Anti-Submarine Squadron (HS) 4 prepare to lift off afte
vehicle2011
US Navy 110315-N-IC111-430 Japanese citizens receive supplies from Sailors assigned to the Black Knights of Helicopter Anti-Submarine Squadron (HS)
hh-60h rescue hawk2011
US Navy 110316-N-SB672-114 Japanese citizens unload food and water from an HH-60H Sea Hawk helicopter assigned to the Black Knights of Helicopter A
hh-60h rescue hawk2011
US Navy 110321-N-IC111-043 Naval Air Crewman 2nd Class Justin Dowd, from Phoenix, surveys areas affected by a tsunami caused by a 9.0 magnitude ear
people2011
US Navy 100717-N-6632S-497 A shooter prepares to launch a T-45C Goshawk training aircraft from the aircraft carrier USS George H.W. Bush (CVN 77). George H.W. Bush is conducting training operations in the Atlantic Ocean
aircraftflight
US Navy 100821-N-6463B-299 U.S. Coast Guard Maritime Enforcement Specialist 3rd Class Cleven Brown climbs a caving ladder during a mock boarding operation in the Red Sea
eotech holographic sightssea
US Navy 100618-N-3852A-004 Sailors guide a Marine Corps V-22 Osprey during flight operations aboard the amphibious assault ship USS Wasp (LHD 1)
militaryvehicle
US Navy 100618-O-8247T-080 Royal Australian Navy Seaman Marine Technician Vikki Howe, from Moora, Australia, checks pressures on a diesel generator in enclosed operating station 1
people of the royal australian navymarine technology
US Navy 060830-N-4097B-014 U.S. Army Lt. Alan Boyes, right, with Charlie Company, 1st Battalion, 68th Armored Regiment, 4th Infantry Division, shakes the hand of an Iraqi army soldier
4th infantry division (united states)forward operating base warhorse
US Navy 050624-F-5820C-002 Officer in Charge Explosive Ordnance Disposal Mobile Unit Five (EODMU-5), Lt. Chris Brown, connects rocket engines in series for disposal during operation Exercise Talisman Sabre 2005
united states navy explosive ordnance disposaltalisman sabre 2005
US Navy 040412-N-0780F-044 A U.S. Navy security patrol boat operates just aft of the Los Angeles-class attack submarine USS Dallas's (SSN 700) tailfin as the submarine is escorted into Souda Bay harbor for a brief port visit
watership
USS Nimitz conducts flight operations. (9084852229)
militaryvehicle
The People's Liberation Army-Navy destroyer Qingdao (DDG 113), foreground, frigate Linyi (FFG 547), and the U.S. Navy guided-missile cruiser USS Lake Erie (CG 70) operate together off Oahu, Hawaii, during a search and rescue exercise
oceansea
A U.S. Navy E-2C Hawkeye aircraft flown by Cmdr. John Hewitt, top, the outgoing commanding officer of Carrier Airborne Early Warning Squadron (VAW) 126, an E-2C flown by Cmdr. Przemyslaw Kaczynski, left 140318-N-ZG705-051
operation enduring freedomvehicle
A-4C launches from USS Enterprise (CVAN-65) 1967
vehiclesea
Defense.gov News Photo 110315-N-5503T-474 - U.S. Navy Petty Officer 2nd Class Chris Carringer passes a case of fresh water from an HH-60H Sea Hawk helicopter to a Japanese citizen during
people2011
Defense.gov News Photo 110307-N-0569K-093 - An F A-18F Super Hornet aircraft assigned to Strike Fighter Squadron 211 prepares to launch from catapult three during cyclic flight operations
militaryvehicle
Operatie Atalanta onderscheiding-3
militarynavy
Manhattanhenge M14 bus lights jeh
skylinecity
Bunny F-4S VX-4 at Point Mugu 1982
militaryvehicle
Domain support call
technologybusiness
Maffei munich cylinder
vehiclecontrol
Agreement concluded january 8 1887 between the state
franceparis
RZD EM4-001 2004-02 Sputnik train at Mytishi station, frost day of operation
vehiclelight
US Navy 100401-N-9818V-332 Chief of Naval Operations Adm. Gary Roughead, Secretary of the Navy (SECNAV) the Honorable Ray Mabus and Master Chief Petty Officer of the Navy (MCPON) Rick West participate in the wreath laying cerem
peoplecity
US Navy 100613-N-6604E-236 Aviation Machinist's Mate 2nd Class Clarice Taylor verifies equipment is operating safely prior to the launch of an F-A-18F Super Hornet aboard USS Dwight D. Eisenhower (CVN 69)
militaryaircraft
US Navy 110315-N-IC111-128 Sailors assigned to the Black Knights of Helicopter Anti-Submarine Squadron (HS) 4 embarked aboard the aircraft carrier
hh-60h rescue hawk2011
US Navy 110318-N-GL340-013 Sailors load food and humanitarian supplies aboard an HH-60H Sea Hawk helicopter assigned to the Black Knights of Helico
hh-60h rescue hawk2011
US Navy 110328-N-0569K-105 An F-A-18E Super Hornet assigned to the Knighthawks of Strike Fighter Squadron (VFA) 136 launches from the aircraft carr
aircraftvehicle
US Navy 110403-N-9950J-278 An MH-60S Sea Hawk helicopter picks up supplies from USNS Matthew Perry (T-AKE 9) during a vertical replenishment
vesselship
US Navy 100203-N-5214S-148 he amphibious assault ship USS Nassau (LHA 4) operates off the coast of Baie de Grand Goave, Haiti, while a CH-53E Super Stallion helicopter flies overhead
aircraftvehicle
US Navy 100206-N-2735T-038 arines from the 22nd Marine Expedition Unit (22nd MEU) carry supplies from an CH-53E Sea Stallion helicopter after arriving at the Civilian Military Operations Center in Carrefour, Haiti
united states navy images from port-au-princehaiti
US Navy 100512-N-0775Y-011 Kings County fire fighters battle a fire on a training simulator during Operation Parkview
californiavehicle
12201 - 12300 of 18,962 Next page
/ 190