14,010 Free Images of Members

waterboatseashipvehicleaircraftnavymilitaryaviationocean
US Navy 091113-N-0890S-486 U.S. Marines and members of the Dominican Republic military deploy from a CH-53 Sea Stallion helicopter
militaryaircraft
US Navy 090723-N-5476H-085 Friends and family members gather along the shoreline to welcome the Virginia-class attack submarine USS Hawaii (SSN 776) as it enters the channel to Pearl Harbor
waterboat
US Navy 090302-N-1688B-082 Sarah Gloo, an Africa Partnership Station staff member embarked aboard the amphibious transport dock ship USS Nashville (LPD 13), shows Ghanaian children their picture while visiting a fishing village
united states navy in sekondi-takoradipeople
US Navy 111219-M-OO345-002 Cpl. Ryan Caldwell, assigned to the 11th Marine Expeditionary Unit (11th MEU), fires an M4 rifle during a live-fire exer
pictures featuring members of the 11th marine expeditionary unitmales with m4 carbine
US Navy 040611-N-1810F-007 Members of the Armed Forces Ceremonial Honor Guard march from the Capitol building as a hearse carrying President Ronald Reagan's remains to the grounds of the Washington National Cathedral
exterior of the united states capitolpeople of the united states navy
US Navy 050307-N-3019M-001 Family members console each other before a ceremonial formation of U.S. Marine Corps infantry equipment during the First Battalion, Third Marine's Memorial Service at the Hawaii State Capitol Bu
hugs involving the militarypeople at pearl harbor
US Navy 060909-N-3271W-003 Lt. Geoff Reeves, a member of the U.S. Navy Parachute Demonstration Team Leap Frogs, prepares to land while the band plays at the pre-game ceremonie
united states navy parachute teampre-game ceremonies
Kaylei Weed, her sons Earl Lebeau (left) and Baptiste Lebeau, and her mother, Elaine Ethel Weed, are members of the Eastern Shoshone tribe at the Wind River Indian Reservation in central Wyoming's Wind River Basin. The reservation was established for the Eastern Shoshone in 1863 following a unique treaty with Shoshone Chief Washakie, admired by Indians and whites alike, on 45 million acres in the land that their ancestors had occupied on a seasonal basis for thousands of years. The reservation is unique: It is also home to a second, unrelated tribe: the Northern Arapahoe, who were placed on the reservation in 1878 with a promise, never fulfilled, of their own reservation in the future. Original image from Carol M. Highsmith’s America, Library of Congress collection. We are proud to support Hope for Children on their mission to ensure children in the most extreme poverty are as happy and content as any other child, enjoying a childhood that sets them up for a fulfilling future - because every child deserves that. As well as donating 10% of our revenue to Hope for Children we have created this special collection FREE for everyone to enjoy. If you can, please visit Hope for Children to give back by donating or to learn about other ways you can support their mission.
native americansfamily
Elizaveta Alexeevna in mourning by G.Dawe (19th c. Royal coll.), George Dawe, after 1 Dec 1825
portraits of elizabeth alexeevna in mourningportraits of elizabeth alexeevna by dawe
MH-60R "Romeo"
air transporthelicopter
120821-N-HW704-022 SAN DIEGO (Aug. 21, 2012) Members of Fleet Logistics Support Squadron (VRC) 30 observe an injured green sea turtle with SeaWorld Rescue Program representatives at Naval Air Station
reptilesanimals
Members of ROCA Dragon Team Jumping from CH-47 Helicopter over ROCMA Ground 20160604
aircraftflight
US Navy 100615-N-4971L-328 Sailors embarked aboard High Speed Vessel Swift (HSV 2) and members of the Nicaraguan navy board a fishing vessel during visit, board, search and seizure subject matter expert exchange operations
fishboat
US Navy 061028-N-0209M-001 A Sailor assigned to Explosive Ordnance Disposal Mobile Unit Three (EODMU-3) detachment 11 deployed aboard USS Boxer (LHD 4) helps hoist a team member into a helicopter during international EOD traini
aboard uss boxer (lhd-4)helihoisting of people
US Navy 071014-N-7088A-065 Members attached to Helicopter Sea Combat Squadron (HSC) 28, secure the propeller on an MH-60S Seahawk aboard Military Sealift Command hospital ship USNS Comfort (T-AH 20)
militaryaircraft
US Navy 050405-N-0357S-002 Australian medics carry one of two Australian service members who survived an April 2, 2005 crash of a Royal Australian Navy Sea King helicopter in Nias, Indonesia, to an awaiting MH-60S Seahawk helic
aboard usns mercy (t-ah-19)stretcher
US Navy 091012-N-5345W-267 An air crew member keeps a look out as an MH-60S Sea Hawk helicopter assigned to the Sea Knights of Helicopter Sea Combat Squadron (HSC) 22 lifts off from the amphibious dock landing ship USS Fort McH
militaryaircraft
US Navy 091029-N-7095C-048 Members of an Australian boarding team disembark a rigid-hull inflatable boat and climb aboard the Military Sealift Command fleet replenishment oiler USNS Walter S. Diehl (T-AO 193) during a Deep Sabr
vehiclewater
US Navy 050903-N-8154G-203 Crew members assigned to the amphibious assault ship USS Bataan (LHD 5) work with combat cargo and Helicopter Mine Countermeasure Squadron Fifteen (HM-15) personnel to pull a generator from the interi
electricity generationmilitary forklifts
US Navy 050312-F-2575F-002 Team members of the FitzBradshaw NASCAR Busch Series Race Team works to get driver David Stremme off pit row
united states navy images from las vegaspit stops in nascar
US Navy 060524-N-7676W-279 Actors Hugh Jackman, right, AKA Wolverine, Ms. Halle Berry, center, AKA Storm, and Kelsey Grammer, left, AKA Dr. Henry McCoy, pose for pictures with crew members
aboard uss kearsarge (lhd-3)new york harbor
US Navy 060216-N-0780F-005 Crew members man the bridge as the Los Angeles-class fast attack submarine USS Annapolis (SSN 760) departs the harbor following a routine port visit
watership
US Navy 061123-N-3560G-022 Members of Naval Mobile Construction Battalion Four (NMCB-4) display their stretcher barer skills during the Super Squad training competition
naval mobile construction battalion 4stretcher
US Navy 070920-N-4014G-055 A rigid hull inflatable boat from guided-missile destroyer USS Porter (DDG 78) maneuvers to pick up a floating dummy simulating an overboard crew member during a man overboard drill
watersea
US Navy 080701-N-5961C-007 Aviation Warfare Systems Operator 2nd Class Slavek Glownia and a villager from Kalibo move a box of humanitarian supplies from an SH-60F Seahawk flown by members of Helicopter Anti-Submarine Squadron
helicopter anti-submarine squadron 4 (united states navy)sh-60f seahawk
US Navy 080722-N-3446M-025 Navy Diver 2nd Class Christopher Peek, assigned to Mobile Diving and Salvage Unit (MDSU) 1 and members of the Indonesian navy dive team help Senior Chief Navy Diver Paul Adams don his head gear before
united states navy diverssurabaya
US Navy 080915-N-8907D-348 Service members embarked aboard the amphibious assault ship USS Kearsarge (LHD 3) unload jugs of drinking water during a humanitarian assistance mission in Haiti
aboard uss kearsarge (lhd-3)vehicle
US Navy 080128-N-0193M-422 Rear Adm. Anthony Kurta kicks out the first ball at a soccer game between members of the Togolese 1st Infantry Regiment and Sailors stationed aboard the high speed vessel (HSV) 2 Swift
association football in the united states navyaboard hsv-2 swift
U.S. Navy Naval Aircrewman (Operator) 2nd Class Clark Urbin, assigned to Patrol Squadron (VP) 16, relays to flight crew members aboard a P-8A Poseidon aircraft flying over the Indian Ocean April 15, 2014, that 140415-N-VD564-050
militaryarmy
Defense.gov News Photo 110319-N-UH963-293 - U.S. Navy sailors and members of the Applied Physics Laboratory Ice Station clear ice from the hatch of the USS Connecticut SSN 22 as it surfaces
winterwater
Defense.gov News Photo 111215-N-PB383-274 - Sgt. Marcos Bustos assigned to the 11th Marine Expeditionary Unit embarked aboard the amphibious dock landing ship USS Pearl Harbor LSD 52 plays
peoplegroup
Jamaal Bowman 117th U.S Congress
list of new members of the 117th united states congressbald men
Deborah Ross 117th U.S Congress
list of new members of the 117th united states congresscelebrities
Starlight Park green ribbon jeh
self-published workcelebrities
US Navy 060830-N-4097B-019 U.S. Army Lt. Alan Boyes, right, with Charlie Company, 1st Battalion, 68th Armored Regiment, 4th Infantry Division, talks to local Iraqi council members through an interpreter
interpretationpeople
US Navy 051218-F-7234P-066 U.S. Navy Petty Officer 2nd Class Dennis Ballais and Chief Petty Officer Zach Holzhausen watch Waleed Humayan Ahmed, a Yemen Explosive Ordinance Disposal (EOD) team member, place an x-ray machine near
bomb suitsyemen
US Navy 100831-N-9643W-314 Chief Master-at-Arms Jose Del Olmo talks with members of the Guyana Defense Force during the NCIS subject matter expert exchange aboard High Speed Vessel Swift (HSV 2)
georgetownguyana
US Navy 100615-N-4971L-315 Sailors deployed aboard High Speed Vessel Swift (HSV 2) and members of the Nicaragua navy prepare to board a mock fishing vessel while conducting visit, board, search and seizure subject matter expert
vehiclewater
US Navy 090805-N-4205W-142 Romanian Chief of Staff Adm. Gheorge Marin and members of his staff ride in a special operations craft-riverine during a visit to the Naval Small Craft Instruction and Technical Training School
vehiclewater
US Navy 090721-N-3262C-113 Cmdr. Jeffrey J. Kim, commanding officer of the guided-missile destroyer USS John S. McCain (DDG 56), explains the ship's capabilities to members of the Japanese media
peoplegroup
US Navy 100118-N-1134L-261 Members of a U.S. Navy and Army joint-service dive task force conduct an assessment of port facilities during an inspection of the port in Port-au-Prince, Haiti
2010 haiti earthquake relief efforts in port-au-princejanuary 2010 in port-au-prince
US Navy 090911-N-0413R-155 Sailors assigned to the amphibious transport dock ship Pre-Commisioning Unit (PCU) New York (LPD 21) and members of the commissioning committee are introduced during a pre-game ceremony at Yankee Stad
united states navy images from new york citystadium
US Navy 091116-N-1291E-196 Members of Helicopter Mine Countermeasures Squadron (HM) 15 wait in rigid hull inflatable boats near the Royal Navy fleet auxiliary service landing ship dock RFA Lyme Bay (L3007)
boatsea
US Navy 070501-N-7955L-027 Golf teams from USS Kearsarge (LHD 3), USS Forest Sherman (DDG 98), USS Gunston Hall (LSD 44), USS Ponce (LPD 15), USS San Jancinto (CG 56) and members of the community prepare for a golf tournament
united states navy images from fort lauderdaleaboard uss gunston hall (lsd-44)
US Navy 081202-N-8467N-003 Crew members assigned to the Military Sealift Command rescue and salvage ship USNS Grasp (T-ARS 51) hook a towing line to submarine NR-1 as the boat makes its way along the Thames River
waterboat
US Navy 080610-N-8298P-052 Members of the U.S. Coast Guard Maritime Safety and Security Team Boston conduct a security dive during a Frontier Sentinel exercise
new hampshirewater
U.S. Navy Lt. Cmdr. David Mims, left, and aircrew members assigned to Patrol Squadron (VP) 16 pose in front of a P-8A Poseidon aircraft in Perth, Australia, April 4, 2014, before departing on a mission 140404-N-VD564-023
aircraftvehicle
Defense.gov News Photo 111202-N-DX615-029 - U.S. Marine Corps Sgt. Alex Sanchez assigned to the 11th Marine Expeditionary Unit uses an M4 carbine to practice weapon malfunction drills in
m16 and stanag magazinesmales with m4 carbine
Schloss caputh albrecht friedrich markgraf zu brandenburg schwedt
17th-century portrait paintings in schloss caputhgedeon romandon
I am the originator of this photo. I hold the copyright. I release it to the public domain. This photo depicts a flower of a member of the Asteraceae, probably an annual Rudbeckia.
naturespring
US Navy 020807-N-2383B-511 CNO speaks with Naval Officers Association members
august 2002 united states photographsmen wearing glasses
US Navy 071218-N-4774B-479 U.S. Marine Sgt. Marilyn Zeledon, network administrator for the 11th Marine Expeditionary Unit (MEU), shows some children from Singapore an exhibit on liquid nitrogen at the Singapore Science Museum
pictures featuring members of the 11th marine expeditionary unitmilitary people of the united states with children
US Navy 081008-N-9818V-269 Master Chief Petty Officer of the Navy (MCPON) Joe R. Campa Jr. cuts the Navy birthday cake with the youngest member in the Junior Reserve Officer Training Corps (JROTC) program at Luther Burbank High
cake cutjr
US Navy 080616-G-2443T-010 t. Placido Ndong, a member of the Equatorial Guinea Navy, practices maritime-law enforcement self-defense techniques with Petty Officer 1st Class Marcus Pereira
people of the cape verde coast guardmilitary of equatorial guinea
US Navy 080626-N-5961C-002 A member of the Philippine Army carries bottled water to a waiting helicopter assigned to Helicopter Anti-Submarine Squadron (HS) 4 at Iloilo airport
helicopter anti-submarine squadron 4 (united states navy)uss ronald reagan (cvn-76) humanitarian aid
US Navy 051218-F-7234P-061 U.S. Navy Chief Petty Officer Zach Holzhausen watches Waleed Humayan Ahmed, a Yemen Explosive Ordinance Disposal (EOD) team member, place an x-ray machine near an Improvised Explosive Device (IED) dur
yemenarmy
US Navy 070823-N-8704K-011 U.S. Navy Showband members attached to the Military Sealift Command hospital ship USNS Comfort (T-AH 20) offload instruments and musical equipment from a UH-60 Blackhawk attached to Joint Task Force B
militaryvehicle
US Navy 070315-N-7130B-152 In a blur, an E-A-6B Prowler, assigned to the Cougars of Tactical Electronic Warfare Squadron (VAQ) 139, launches from the flight deck of USS Ronald Reagan (CVN 76) as ground crew member
aircraftvehicle
US Navy 091121-N-1291E-026 Members of Helicopter Mine Countermeasures Squadron (HM) 15 in a rigid hull inflatable boat (RHIB) throw a line to Aviation Electronics Technician Airman Anthony Skubon to launch a MK-105 Mod 4 Sled
waterboat
US Navy 040121-N-0780F-015 The guided missile destroyer USS Cole (DDG 67) arrives for short port visit. This is USS Cole's first deployment since a terrorist attack on the ship killed 17 crew members and injured 39 other
boatsea
US Navy 100529-N-0413B-002 Members of Mobile Diving Salvage Unit (MDSU) 1 and Joint POW-MIA Personnel Accounting Command (JPAC) offload a zodiac after two hours of underwater recovery searches during a JPAC recovery mission in
waterboat
US Navy 100512-N-4205W-145 A U.S. Navy special warfare combatant-craft crewman explains the maintenance procedures of an outboard motor to members of the Brazilian Marine Corps Special Operations Battalion
jet drives outboardsarmy
US Navy 050728-N-4772B-428 Indonesian Navy boarding team members ride one of the amphibious dock landing ship USS Harpers Ferry's (LSD 49) small boats from the Indonesian frigate Karel Satsuit Tubun (KST 356) to the guided miss
boatsea
US Navy 050812-F-0365G-010 Three teams of service members from the Joint POW-MIA Accounting Command (JPAC) paddle their zodiac rafts to the shore during zodiac training at Hickam Harbor
watersea
US Navy 050909-N-1467R-077 A U.S. Marine assigned to 11th Marine Expeditionary Unit (MEU-11) stationed at Camp Pendleton, Calif., cuts a fallen tree as part of the cleaning efforts st D'Iberville Elementary School
pictures featuring members of the 11th marine expeditionary unithurricane katrina aftermath in d'iberville
Stephanie Bice 117th U.S Congress
religious affiliation in the united states house of representativeslist of new members of the 117th united states congress
Defense.gov News Photo 110801-N-ZZ999-145 - Petty Officer 3rd Class Alexis Johnson serves as a member of the rifle guard aboard the aircraft carrier USS John C. Stennis CVN 74 during a burial
uss john c. stennis (cvn-74)color guard
Defense.gov News Photo 110801-N-XM900-206 - Members of the color guard aboard the aircraft carrier USS John C. Stennis CVN 74 parade the colors during a burial at sea while underway in the
aboard uss john c. stennis (cvn-74)uss john c. stennis (cvn-74)
Guardian officials official
familymale
Guardian officials official
familymale
WikiProject Scouting BSA ex-member
media lacking a descriptionpd-user
Members of the City Troop and Other Philadelphia Soldiery, Pavel Svinyin
paintings by john lewis krimmelpavel svinyin
Izabela Lubomirska with a statue of Henryk Lubomirski as a genius of fame, Carl Hummel, 1816
izabela lubomirska (née czartoryska)carl ludwig hummel de bourdon
Dupuy - Élisabeth Charlotte d'Orléans, Duchess of Lorraine, Nicolas-Philippe Dupuy
portrait paintings of élisabeth charlotte d'orléansnicolas dupuy
People
peopledog
People
childrentravel
Businessman work working
businessmale
Businessman work working
businessmale
US Navy 100408-N-6138K-237 Musician 2nd Class Justin Strauss, a member of the U.S. Naval Forces Europe Band, Five Star Brass Quintet, high-fives children following a performance at the Colin Powell Cultural Center
celebritiespeople
US Navy 100831-N-9643W-246 Chief Master-at-Arms Jose Del Olmo, left, and Chief Hospital Corpsman Tracie Ham greet members of the Guyana Defense Force before the start of subject matter expert exchanges aboard High Speed Vessel
georgetownpeople
US Navy 120112-N-KD852-138 Marines assigned to the 11th Marine Expeditionary Unit (11th MEU) position themselves on the flight deck after fast ropi
eotech holographic sightsmales with m4 carbine
US Navy 100118-N-1134L-241 Members of a U.S. Navy and Army joint-service dive task force conduct an assessment of port facilities during an inspection of the port in Port-au-Prince, Haiti
2010 haiti earthquake relief efforts in port-au-princejanuary 2010 in port-au-prince
US Navy 090321-N-7130B-095 Chief Explosive Ordnance Disposal Technician Kenneth Simpson watches as a member of the Armed Forces of the Philippines Army Explosive Ordnance Disposal Unit places an explosive tool
joint special operations task force - philippinesunited states navy explosive ordnance disposal
US Navy 050207-N-3019M-006 Family members wave goodbye to their loved ones aboard the Arleigh Burke-class guided missile destroyer USS O'Kane (DDG 77) as she leaves Pearl Harbor, Hawaii for a scheduled deployment
aboard uss carl vinson (cvn-70)sea
US Navy 031024-N-3228G-008 Members of the official greeting party and interpreters prepare for a press conference in front of Federation Navy Udaloy Class destroyer Marshal Shaposhnikov (DDG 543)
navy1985
US Navy 080818-N-5821P-033 Italian technicians working for the 405th Army Field Support Battalion assist Fleet Logistics Support Squadron (VR) 46 crew members in loading humanitarian supplies onto a C-9B Skytrain
militaryaircraft
US Navy 080913-N-8907D-053 Service Members embarked aboard the amphibious assault ship USS Kearsarge (LHD 3), stack bags of rice during a humanitarian assistance mission in Haiti
sikorsky ch-53e super stallion (us marine corps)food relief
US Navy 080914-N-3595W-145 Service members embarked aboard the amphibious assault ship USS Kearsarge (LHD 3) load supplies onto a CH-53E Super Stallion helicopter for delivery to areas affected by recent hurricanes in Haiti
sikorsky ch-53e super stalliontransport in port-au-prince
US Navy 080626-N-5345W-103 Fire team members assigned to the aircraft carrier USS Carl Vinson (CVN 70) attempt to put out a controlled fire
sailors from the united states navypeople with helmets
Liberian service members aboard a Spanish Civil Guard boat prepare to board a vessel during maritime interdiction training March 8, 2014, in Dakar, Senegal, as part of exercise Saharan Express 2014 140308-N-QY759-227
vehiclewater
Many journalists pose with President Nixon on 28 February 1972, including Helen Thomas, Barbara Walters, Dan Rather, and Walter Cronkite, from- President Nixon and members of the press in Shanghai - NARA - 194428 (cropped)
peoplegroup
US Navy 030826-N-4374S-022 A member of Special Boat Team 20 (SBT-20) keeps a close watch during a recovery evolution by an MH-60S Kighthawk assigned to Chargers of Helicopter Combat Support Squadron SIX (HC-6)
militaryarmy
US Navy 040212-N-5319A-007 Members assigned to Explosive Ordnance Disposal Mobile Unit Six (EODMU 6) carry their fast rope back to an HH-60H Seahawk helicopter
fast ropenavy
US Navy 100831-N-4044H-206 Members of the Papua New Guinea Defense Force prepare to embark aboard the Royal Australian Navy landing ship heavy HMAS Tobruk (L50)
vehicleboat
US Navy 090319-N-9573A-014 Seabees assigned to Underwater Construction Team (UCT) 2 and Mobile Diving and Salvage Unit participate in an underwater welding exercise with members of the Republic of Korea Navy
vehiclewater
US Navy 090422-N-7130B-108 Explosive Ordnance Disposal Technician 2nd Class Travis Becker helps a member of the Armed Forces of the Philippines Army Explosive Ordnance Disposal Battalion tape together two pieces of detonation c
joint special operations task force - philippinesunited states navy explosive ordnance disposal
US Navy 071111-N-3659B-411 Members of Mobile Security Squadron 3, Visit Board Search and Seizure detachment, advance across the flight deck as part of an air demonstration
militaryaircraft
US Navy 080915-N-8907D-039 Service members embarked aboard the amphibious assault ship USS Kearsarge (LHD 3) unload food and water during disaster relief support to areas affected by recent hurricanes in Haiti
waterboat
US Navy 080922-N-9620B-003 Haitian relief workers help U.S. military service members embarked aboard the amphibious assault ship USS Kearsarge (LHD 3) unload food and water to aid those affected by the recent hurricanes that ha
aboard uss kearsarge (lhd-3)people
President Ronald Reagan Signing Executive Order on Federal Hiring Freeze and Cabinet Member Nominations
ronald reagan and george h. w. bushtip o'neill
7101 - 7200 of 14,010 Next page
/ 141