6,785 Free Images of Hawk

vehiclenavyaircraftmilitaryshipaviationboatjetmh-60s seahawksea
US Navy 060702-N-4776G-501 An HH-60H Seahawk assigned to Helicopter Anti-Submarine Warfare Squadron Four (HS-4), fires flairs during an air demonstration
aircraftvehicle
US Navy 060822-N-8604L-317 Chief Aviation Boatswain's Mate Handling Jimmy Candelaria prepares to direct an E-2C Hawkeye assigned to Carrier Airborne One One Five (VAW-115) during a no-fly day aboard the conventionally-powered a
aviation boatswain's matehandler
US Navy 061115-N-6106R-003 Aviation Machinist's Mate 2nd Class Eric Vaughn installs a cannon plug on a fuel control component of an F-A-18 Super Hornet F414-GE-400 engine in USS Kitty Hawk's (CV 63) jet shop
aboard uss kitty hawk (cv-63)aircraft engine testing
US Navy 080711-N-3946H-013 Aviation Electronics Technician 3rd Class Justin Gonzalez, of San Antonio, Texas, troubleshoots the radar system of an EA-6B Prowler assigned to Electronic Attack Squadron (VAQ) 136
aviation electronics technicianaboard uss kitty hawk (cv-63)
US Navy 080711-N-3946H-116 Aviation Structural Mechanic 2nd Class Wesley Goodwin, of Flint, Mich., performs maintenance on the arresting hook of a Strike Fighter Squadron (VFA) 195 F-A-18C Hornet
aircraftvehicle
US Navy 081018-N-9928E-152 Senior Chief Explosive Ordnance Disposal Jon Culver fast ropes from an MH-60S Sea Hawk
aircraftnavy
US Navy 110321-N-3005P-396 Sailors watch as an SH-60F Sea Hawk helicopter lifts off from the fight deck of the U.S. 7th Fleet command ship USS Blue
cargo net2011
US Navy 110213-N-0569K-142 An MH-60S Sea Hawk helicopter assigned to the Sea Knights of Helicopter Logistics Support Squadron (HSC) 22, transports
uss enterprise (cvn-65) flight deckmh-60s seahawk
US Navy 110426-O-ZZ999-005 An MH-60S Sea Hawk helicopter assigned to the Wild Cards of Helicopter Sea Combat Squadron (HSC) 23 transports supplies
aboard uss cleveland (lpd-7)ship
US Navy 090930-N-1688B-423 oatswain's Mate 2nd Class Brandon Carney, from Stratford, N.J., directs an SH-60 Sea Hawk helicopter assigned to the Vipers of Helicopter Anti-Submarine Squadron Light (HSL) 48
sh-60b seahawknavy
US Navy 091105-N-6233H-088 An SH-60F Sea Hawk helicopter assigned to the Chargers of Helicopter Anti-Submarine Squadron (HS) 14 lifts cargo from the aircraft carrier USS George Washington (CVN 73)
aircraftnavy
US Navy 091105-N-1644H-184 Two SH-60F Sea Hawk helicopters assigned to the Chargers of Helicopter Anti-Submarine Squadron (HS) 14 transport cargo to the aircraft carrier USS George Washington (CVN 73)
militarynavy
US Navy 091116-N-1291E-122 Explosive Ordnance Disposal Technician 2nd Class Robert Gangeris lifted out of the Persian Gulf onto an SH-60 Sea Hawk helicopter during a joint nations exercise in the Persian Gulf
explosive ordnance disposal technician (united states navy)united states navy in the persian gulf
US Navy 091114-N-2475A-294 Logistics Specialist 3rd Class Paul Scott and Logistics Specialist 3rd Class Christopher Duane hook cargo onto an MH-60S Sea Hawk helicopter
aboard uss john c. stennis (cvn-74)logistic specialist
US Navy 090727-N-3038W-104 An SH-60F Sea Hawk helicopter assigned to the Indians of Helicopter Anti-Submarine Squadron (HS) 6 takes off from the aircraft carrier USS Nimitz (CVN 68)
aircraftvehicle
US Navy 091208-N-9928E-144 Aviation Structural Mechanic 3rd Class Tyler Clausen signals an MH-60S Sea Hawk helicopter aboard USS John C. Stennis (CVN 74)
aboard uss john c. stennis (cvn-74)vehicle
US Navy 100127-N-7508R-177 A Sailor carries a chock and chain to secure an MH-60S Sea Hawk helicopter assigned to Helicopter Sea Combat squadron (HSC) 22
helicopter sea combat squadron 22 (united states navy)aboard uss bataan (lhd-5)
US Navy 100310-N-7058E-148 A Sailor assigned to Helicopter Sea Combat Squadron (HSC) 22 works on an MH-60S Sea Hawk helicopter aboard the littoral combat ship USS Freedom (LCS 1)
helicopter sea combat squadron 22 (united states navy)navy
US Navy 100406-N-7364R-142 Aviation Machinist's Mate 2nd Class Scott Lister, assigned to the Dragonwhales of Helicopter Sea Combat Squadron (HSC) 28, performs maintenance on the main rotor head of an MH-60S Sea Hawk helicopter
helicopter sea combat squadron 28 (united states navy)naval support activity naples
US Navy 100322-N-4236E-269 An HH-60H Sea Hawk helicopter prepares to land while an F-A-18E Super Hornet crosses the flight deck
militaryvehicle
US Navy 100323-N-7478G-280 Sailors launch an SH-60F Sea Hawk helicopter from the U.S. 7th Fleet command ship USS Blue Ridge (LCC 19)
nightdark
US Navy 051114-N-9500T-046 An HH-60H Seahawk helicopter prepares to takeoff for a night training mission from Naval Air Facility (NAF) El Centro, Calif
naval air facility el centrohh-60h rescue hawk
US Navy 101029-N-3154P-104 Aviation Boatswain's Mate (Handling) 3rd Class David Neiman directs an MH-60S Sea Hawk helicopter assigned to Helicopter
militaryaircraft
US Navy 100715-N-4830B-049 Aviation Boatswain's Mate (Handling) 3rd Class Bryan Rice, from Linwood, Wash., signals to the pilot of an MH-60S Sea Hawk helicopter
aircraftflight
US Navy 061110-N-1332Y-427 Aviation Structural Mechanic (Equipment) 2nd Class Anthony Abraham (top), from Cebu, Philippines, and Aviation Structural Mechanic (Equipment) Airman Van Lam, from Grand Prairie, Texas, replace air du
aviation structural mechaniclowlight
US Navy 111130-N-RJ456-029 he Arleigh Burke-class guided-missile destroyer USS Russell (DDG 59) transits alongside as an MH-60S Sea Hawk helicopter
boatsea
US Navy 111130-N-BT887-003 A Sailor wipes down the tail rotor of an MH-60R Sea Hawk helicopter assigned to the Raptors of Helicopter Maritime Strik
aboard uss john c. stennis (cvn-74)helicopter tail rotors
US Navy 120110-N-OY799-183 An MH-60S Sea Hawk from the Eightballers of Helicopter Sea Combat Squadron (HSC) 8 carries pallets past the Ticonderoga
shipsea
The silhouette of a northern harrier on Seedskadee NWR. As their former common name, marsh hawk, suggests they are birds of the marshes. They hover and glide on the winds above emergent vegetation,
animalsbird
Image title: Man lecturer teaches teenagers about birds Image from Public domain images website, http://www.public-domain-image.com/full-image/people-public-domain-images-pictures/crowd-public-domain-
animalsbird
Hawk incense burner, Japanese, purchased 1901, cast silver with lacquer perch - George Walter Vincent Smith Art Museum - DSC03566
self-published workcc-zero
Flickr - Official U.S. Navy Imagery - Aviation Ordnanceman 3rd Class Daniel Coggins and Aviation Ordnanceman Airman Eric Fernandez clear the area for an MH-60S Sea Hawk helicopter.
militaryaircraft
US Navy 091022-N-7478G-278 Lt. Cmdr. Loren Romeus, assigned to Helicopter Antisubmarine Squadron Light (HSL) 51, attaches straps to the top hood of an SH-60F Sea Hawk helicopter for inspection before flight quarters
aircraftvehicle
US Navy 091022-N-7478G-279 Lt. Cmdr. Loren Romeus, left, and Lt. Cmdr. Clark Hickingbottom, assigned to Helicopter Antisubmarine Squadron Light (HSL) 51, inspect an SH-60F Sea Hawk helicopter before flight quarters
aircraftvehicle
US Navy 091106-N-0807W-652 Boatswain's Mate 3rd Class Solomon Michelsignals an MH-60S Sea Hawk helicopter
helicopter sea combat squadron 25 (united states navy)navy
US Navy 091112-N-6233H-019 An SH-60F Sea Hawk helicopter from the Chargers of Helicopter Anti-Submarine Squadron (HS) 14 lifts off the flight deck of aircraft carrier USS George Washington (CVN 73)
sh-60f seahawk in flighthelicopters in flight
US Navy 101118-N-0000X-001 A U.S. Navy MH-60S Sea Hawk helicopter assigned to the Blackjacks of Air Test and Evaluation Squadron (HX) 21 tests a 50
air test and evaluation squadron 21 (united states navy)mh-60s seahawk
US Navy 110320-N-DM338-219 Machinist's Mate 1st Class Lucas Kasper, from Yorba Linda, Calif., scans an SH-60B Sea Hawk helicopter assigned to the W
militarypeople
US Navy 110322-N-DM338-120 Sailors and Marines load food and humanitarian assistance supplies onto an SH-60B Sea Hawk helicopter
aircraftvehicle
US Navy 110514-N-XO436-054 An MH-60S Sea Hawk helicopter assigned to the Dragon Whales of Helicopter Sea Combat Squadron (HSC) 28
vehiclenavy
US Navy 110602-N-GZ277-044 An HH-60H Sea Hawk helicopter assigned to Helicopter Anti-Submarine Squadron (HS) 15 picks
militaryvehicle
US Navy 110607-N-RC734-033 MH-60S Sea Hawk helicopters carry supplies between USNS Bridge (T-AOE 10) and USS Comstock (LSD 45) during a vertical re
boatship
US Navy 110726-N-RM525-342 An MH-60S Sea Hawk helicopter transfers cargo from USNS Comfort (T-AH 20) to USNS Lewis and Clark (T-AKE 1)
militaryship
US Navy 090707-N-9132C-075 A MH-60S Sea Hawk assigned to the Black Jacks from Helicopter Sea Combat Squadron (HSC) 21 transports cargo from USNS Rainier
mh-60s seahawknavy
US Navy 100927-N-2855B-203 USS Stout (DDG 55) cruises through the Atlantic Ocean while two SH-60B Sea Hawk helicopters hover close by during routin
vehiclesea
US Navy 031005-N-2143T-001 Explosive Ordnance Disposal Mobile Unit Eleven Detachment One (EODMU-11, DET 1) fast rope
militaryvehicle
US Navy 060421-N-1332Y-034 Commander, Carrier Strike Group five (CSG-5), Rear Adm. Douglas McClain, conducts a tour of USS Kitty Hawk's (CV 63) navigation bridge for members of the Japanese American Wives Association
interiors of nautical bridgesaboard uss kitty hawk (cv-63)
US Navy 081227-N-1082Z-002 An SH-60B Sea Hawk conducts a vertical replenishment with Military Sealift Command fleet replenishment oiler USNS Tippecanoe (T-AO 199)
boatsea
US Navy 080909-N-7981E-072 An SH-60F Sea Hawk helicopter assigned to the
militaryvehicle
US Navy 061127-N-1332Y-041 Aviation Electrician's Mate Airman David Hartmon, from Somerset, Wis., removes a part from the tail section of an SH-60B Seahawk assigned to Helicopter Anti-Submarine Squadron Light Five One (HSL-51)
aboard uss kitty hawk (cv-63)aviation electrician's mate
US Navy 080917-N-5642P-194 Aviation Warfare Systems Operator 2nd Class Julio Molina loads an SH-60 Sea Hawk with mail
helicopter sea combat squadron 28 (united states navy)united states navy images from port-au-prince
US Navy 080929-N-2183K-093 An MH-60S Sea Hawk lifts cargo off the flight deck of the Military Sealift Command fleet replenishment oiler USNS Pecos (T-A0 197)
mh-60s seahawksea
US Navy 070620-N-7883G-014 Aviation Machinist's Mate 3rd Class Francis Falguera practices knee-kicking techniques on a target shield held by Master-at-Arms 2nd Class Charles Gibbs aboard USS Kitty Hawk (CV 63)
aviation machinist's matemaster-at-arms
US Navy 100113-N-8590G-006 Sailors assigned to Helicopter Anti-Submarine Squadron (HS) 7 board SH-60 Sea Hawk helicopters at Naval Air Station Jacksonville as naval air crewmen prepare for departure to the aircraft carrier USS
militaryvehicle
US Navy 100525-N-0864H-289 Seaman Drew Iverson lands an SH-60F Sea Hawk helicopter aboard the U.S. 7th Fleet command ship USS Blue Ridge (LCC 19)
helicopters in flightvehicle
US Navy 090617-N-6720T-007 Aviation Structural Mechanic 2nd Class Patrick Maw signals to the pilot of an HH-60H Sea Hawk helicopter from the Chargers of Helicopter Anti-submarine Squadron (HS) 14 to lift-off
militaryaircraft
US Navy 100205-N-1082Z-005 An MH-60S Sea Hawk helicopter assigned to Helicopter Sea Combat Squadron (HSC) 28, takes off from the amphibious dock landing ship USS Ashland (LSD 48)
helicopter sea combat squadron 28 (united states navy)ship
US Navy 021114-N-3236B-019 Hornet launches from the flight deck
militaryvehicle
US Navy 111212-N-OY799-217 Two MH-60S Sea Hawk helicopters, assigned to the Eightballers of Helicopter Sea Combat Squadron (HSC) 8, pick up stores
boatship
US Navy 111218-N-BT887-057 A Sailor gives the signal to add tension to the catapult to launch an E-2C Hawkeye assigned to the Golden Hawks of Airbo
militaryvehicle
US Navy 111228-N-ED900-562 Ensign Adam Powell keeps watch as other team members prepare a rescue litter for an MH-60R Sea Hawk helicopter assigned
aboard uss pinckney (ddg-91)mh-60r seahawk in flight
US Navy 110821-N-RC734-110 Flight deck personnel wait as an MH-60S Sea Hawk helicopter assigned to the Wildcards of Helicopter Sea Combat Squadron
militaryvehicle
US Navy 110829-N-GH121-045 An MH-60S Sea Hawk helicopter assigned to the Dragon Whales of Helicopter Sea Combat Squadron (HSC) 28 picks up stores f
boatsea
US Navy 111013-N-BT887-001 Airman Michael Ryan, from Tempe, Ariz., watches as an MH-60S Sea Hawk helicopter delivers cargo
vehiclewater
This great-horned owl has been spotted hanging out near the Bloomington visitor center at Minnesota Valley National Wildlife Refuge. Barred owls, bald eagles and a variety of hawks have also been spot
animalsbird
A Northern harrier hovers above a flock of red-winged blackbirds burrowed into the cattails. Northern harriers, previously called marsh hawks, are birds of the wind. On breezy days, they soar, glide
animalsbird
PL XXX I ASTUR CRUENTUS (Gould) Wes t - Aus t raha n Goshawk G J B ro i n owski , Feci t 2 ACCIPITER TORQUATUS (V.giHorsf) Collared S pa pro* - Hawk
animalsbird
US Navy 090511-N-1644H-005 PACIFIC OCEAN (May 11, 2009) An MH-60S Sea Hawk helicopter assigned to the Island Knights of Helicopter Sea Combat Squadron (HSC) 25 lifts off
militaryaircraft
US Navy 090521-N-3570S-012 A team of U.S. Navy search and salvage specialists depart Naval Base Point Loma to continue search efforts for a downed HH-60 Sea Hawk helicopter
vehiclewater
US Navy 090725-N-8534H-040 Aviation Electronics Technician 2nd Class Nicholas Briscoe, assigned to the Chargers of Helicopter Anti-Submarine Squadron (HS) 14, troubleshoots the communications system on an SH-60F Sea Hawk helico
peoplelight
US Navy 090807-N-9132C-110 A crewmember assigned to the Military Sealift Command fast combat-support ship USNS Rainier (T-AOE 7) and an MH-60S Sea Hawk helicopter
helicopters at uss ronald reagan (cvn-76)mh-60s seahawk
US Navy 090814-N-2344B-008 Aviation Machinist's Mate Airman James Fuller installs a tail gear box cowling on an SH-60F Sea Hawk helicopter assigned to the Black Knights of Helicopter Anti-Submarine Squadron (HS) 4 aboard the ai
sh-60f seahawkpeople
US Navy 100119-N-4236E-140 The guided-missile cruiser USS Hue City (CG 66) prepares for a replenishment at sea while MH-60S Sea Hawk helicopters
helicopter sea combat squadron 26 (united states navy)uss hué city (cg-66)
Buzzards bird of prey raptor
animalsbird
Hawk, Jingdezhen, China, 1735-1750 AD, porcelain - Peabody Essex Museum - Salem, MA - DSC05322
self-published workcc-pd-mark
US Navy 081002-N-4236E-087 An MH-60S Sea Hawk passes by the amphibious transport dock ship USS San Antonio (LPD 17)
vehicleboat
US Navy 091008-N-5345W-086 Boatswain's Mate 1st Class Courtney Bacchas is braced by Seaman Michale Sturdevant while signaling the pilot of an MH-60S Sea Hawk helicopter assigned to the Sea Knights of Helicopter Sea Combat Squad
helicopter sea combat squadron 22 (united states navy)aboard uss fort mchenry (lsd-43)
US Navy 090617-N-4879G-016 Deck division Sailors aboard the guided-missile frigate USS Doyle (FFG 39) chain-down an SH-60B Sea Hawk helicopter assigned to the Battle Cats of Helicopter Anti-Submarine Squadron Light (HSL) 43, De
uss doyle (ffg-39)vehicle
US Navy 090616-N-3165S-040 An MH-60B Sea Hawk helicopter transfers a pallet of supplies from the multi-purpose amphibious assault ship USS Bataan (LHD 5) to the the amphibious transport dock ship USS Ponce (LPD 15)
militaryvehicle
US Navy 090522-N-0640K-113 The mine countermeasures ship USS Champion (MCM 4) arrives at Naval Base San Diego after participating in search efforts for a downed HH-60 Sea Hawk helicopter
boatsea
US Navy 090610-N-0413R-676 A multi-mission MH-60R Sea Hawk helicopter, assigned to the Spartans of Helicopter Maritime Strike Squadron (HSM) 70, takes part in a gun exercise off the coast of Jacksonville, Florida
helicopter maritime strike squadron 70 (united states navy)wave
US Navy 090610-N-0413R-200 A Sailor assigned to the Spartans of Helicopter Maritime Strike Squadron (HSM) 70 prepares to chock and chain a multi-mission MH-60R Sea Hawk helicopter at Naval Air Station Jacksonville, Fla
helicopter maritime strike squadron 70 (united states navy)wheel chocks
US Navy 100814-N-1226D-399 Marines hook up a cargo net to an MH-60S Sea Hawk helicopter aboard USS Peleliu (LHA 5)
militaryaircraft
US Navy 100323-N-6003P-067 An SH-60F Sea Hawk helicopter assigned to the Dusty Dogs of Helicopter Anti-submarine Squadron (HS) 7 lands aboard the Nimitz-class aircraft carrier USS Harry S. Truman (CVN 75)
aboard uss harry s. truman (cvn-75)vehicle
US Navy 100719-N-1675O-213 Culinary Specialist 3rd Class Drew Iverson launches an SH-60F Sea Hawk helicopter from the U.S. 7th Fleet command ship USS Blue Ridge (LCC 19)
aircraftvehicle
US Navy 100518-N-6509M-001 Sailors assigned to USS George H.W. Bush (CVN 77) direct an MH-60S Sea Hawk helicopter during a vertical replenishment
militaryaircraft
US Navy 101025-N-7103C-076 An MH-60S Sea Hawk helicopter assigned to the Island Knights of Helicopter Sea Combat Squadron (HSC) 25 lifts cargo from
usns carl brashear (t-ake-7)mh-60s seahawk
US Navy 101118-N-0000X-003 A U.S. Navy MH-60S Sea Hawk helicopter assigned to the Blackjacks of Air Test and Evaluation Squadron (HX) 21
aircraftvehicle
US Navy 100118-N-0515W-013 Aviation Boatswain's Mate (Handling) Airman Miguel Melendres removes chocks and chains from SH-60 Sea Hawk helicopter aboard the amphibious assault ship USS Bonhomme Richard (LHD 6) during flight oper
aboard uss bonhomme richard (lhd-6)aviation boatswain's mate
US Navy 100127-N-7508R-121 An MH-60S Sea Hawk helicopter from Helicopter Sea Combat Squadron (HSC) 22 prepares to carry supplies from the Military Sealift Command
helicopter sea combat squadron 22 (united states navy)aboard uss bataan (lhd-5)
US Navy 110726-F-ET173-041 An MH-60S Sea Hawk helicopter transfers cargo from USNS Comfort (T-AH 20) to USNS Lewis and Clark (T-AKE 1)
boatship
US Navy 111020-N-BT887-291 An MH-60S Sea Hawk helicopter assigned to the Eightballers of Helicopter Sea Combat Squadron (HSC) 8, lifts cargo
vehicleboat
US Navy 120105-N-OY799-079 An MH-60S Knight Hawk helicopter from the Eightballers of Helicopter Sea Combat Squadron (HSC) 8 picks up stores from th
vehicleboat
US Navy 071114-N-7883G-025 Operations Specialist 1st Class Marlon Patterson stands the ship's weapons coordinator watch in the combat direction center aboard the aircraft carrier USS Kitty Hawk's (CV 63)
lightnight
US Navy 071116-N-5387K-043 A Japan Maritime Self-Defense Force (JMSDF) P-3C Orion flies above the aircraft carrier USS Kitty Hawk (CV 63) during a 19-ship group photo exercise
militaryvehicle
US Navy 090224-N-6538W-938 An MH-60R Sea Hawk helicopter prepares to land aboard USS John C. Stennis (CVN 74)
militaryaircraft
US Navy 081114-N-3659B-426 An MH-60S Sea Hawk flies past the Ticonderoga-class guided-missile cruiser USS Chancellorsville (CG 62) during a vertical replenishment
oceansea
US Navy 081114-N-7571S-007 An MH-60S Sea Hawk transports supplies to the Nimitz-class aircraft carrier USS Theodore Roosevelt (CVN 71)
aircraftvehicle
USS Badger (FF-1071) turns away after refueling from USS Sacramento (AOE-1) in the Pacific Ocean on 16 March 1978
vehiclesea
US Navy 040814-N-8704K-010 Aboard USS John F. Kennedy (CV 67), crew members including medical personnel assist Iranian mariners off an HH-60H Seahawk belonging to the Red Lions of Helicopter anti-submarine Squadron Fifteen (HS
aboard uss john f. kennedy (cv-67)hh-60h rescue hawk
3501 - 3600 of 6,785 Next page
/ 68