6,457 Free Images of Hawk

navyvehiclemilitaryaircraftshipseaaviationboataboard uss john c. stennis (cvn-74)aboard uss kitty hawk (cv-63)
US Navy 071114-N-7883G-017 Lt. Cmdr. Abe Younce, top right, Lt.j.g. Eric Steidle and Lt. Gary Donley stand watch with liaison officers of the Japan Maritime Self-Defense Force (JMSDF)
aboard uss kitty hawk (cv-63)light
US Navy 080618-N-1038M-038 Aerographer's Mate 2nd Class Kristopher Rodriguez, a native of Baltimore, Md., writes a weather report in the meteorology and oceanography center of the aircraft carrier USS Kitty Hawk (CV 63)
aerographer's mateindoor
US Navy 021029-N-2781V-050 A U.S. Navy HH-60H helicopter assigned to the Antisubmarine Squadron One Five (HS-15)
militaryvehicle
US Navy 021029-N-2781V-088 A U.S. Navy HH-60H helicopter assigned to Antisubmarine Squadron One Five (HS-15)
aircraftvehicle
PRT Farah conducts medical evacuation training with Charlie Co., 2-211th Aviation Regiment at Forward Operating Base Farah 130109-N-IE116-316
forward operating base farahuh-60 black hawk
US Navy 021127-N-1810F-002 Sailors from the aircraft carrier's Supply Department retreat from below a CH-46 Sea Knight helicopter
aboard uss kitty hawk (cv-63)navy
US Navy 100129-N-6692A-051 Sailors execute a vertical replenishment with an MH-60S Sea hawk helicopter aboard the amphibious dock landing ship USS Harpers Ferry (LSD 49)
militaryaircraft
US Navy 091104-N-3038W-340 Two MH-60S Sea Hawk helicopters assigned to the Wildcards of Helicopter Sea Combat Squadron (HSC) 23
militaryaircraft
US Navy 100124-N-4971L-086 Sailors aboard USS Fort McHenry (LSD 43) carry injured Haitian medical evacuees to an MH-60S Sea Hawk helicopter
helicopter sea combat squadron 26 (united states navy)people
US Navy 100124-N-4971L-041 Sailors aboard USS Fort McHenry (LSD 43) carry injured Haitian medical evacuees to an MH-60S Sea Hawk helicopter
helicopter sea combat squadron 26 (united states navy)winter
US Navy 090930-N-1688B-096 Sailors aboard the guided-missile destroyer USS Cole (DDG 67) use chocks and chains to secure an SH-60 Sea Hawk helicopter
sh-60b seahawkvehicle
US Navy 091117-N-1644H-168 USS Connecticut (SSN 22) transits in front of USS George Washington (CVN 73) while an SH-60F Sea Hawk helicopter flies overhead
watersea
US Navy 080917-N-8132M-112 A flight survey of Galveston, Texas, is conducted by an MH-60S Sea Hawk helicopter
villagewater
US Navy 090610-N-0413R-153 Two multi-mission MH-60R Sea Hawk helicopters fly in tandem during section landings at Naval Air Station Jacksonville, Fla
militaryvehicle
US Navy 090428-N-2638R-001 Ship's Serviceman Seaman Johnnie Jackson and Damage Controlman Fireman Terrel Rowan, both from Houston, wear hot suits as they assist the pilot of an SH-60B Sea Hawk
fire proximity suitspeople
US Navy 070913-N-7883G-016 Aviation Support Equipment Technician 3rd Class Aaron Meyer inventories heat transfer fluid containers in USS Kitty Hawk's (CV 63) forward hazardous materials storeroom
aviation support equipment technicianaboard uss kitty hawk (cv-63)
US Navy 071211-N-9623R-003 Seabees from Naval Mobile Construction Battalion (NMCB) 17 load a patient into a UH-60 Blackhawk medical evacuation helicopter
fort hunter liggettuh-60 black hawk
US Navy 110315-N-3729D-119 Sailors aboard the amphibious assault ship USS Peleliu (LHA 5) hook a cargo net of ammunition to an MH-60S Sea Hawk heli
militaryvehicle
US Navy 110327-N-8607R-022 A Japan Maritime Self-Defense Force S-70B Sea Hawk helicopter lands abaord the forward-deployed amphibious assault ship
militaryvehicle
US Navy 060323-N-7526R-006 Amphibious command ship USS Blue Ridge (LCC 19) flight deck phone talker, Seaman Elliot Kaiser, looks over the flight deck as an Army UH-60L
aboard uss blue ridge (lcc-19)uh-60l black hawk
US Navy 100727-N-7317W-005 An SH-60 Sea Hawk helicopter assigned to the Dusty Dogs of Helicopter Anti-Submarine Squadron (HS) 7, lifts off from the aircraft carrier USS Harry S. Truman (CVN 75)
aboard uss harry s. truman (cvn-75)
US Navy 101202-N-2013O-266 An MH-60S Sea Hawk helicopter assigned to the Island Knights of Helicopter Combat Support Squadron (HSC) 25 carries ordn
helicopter sea combat squadron 25 (united states navy)vehicle
US Navy 061127-N-1332Y-140 Aviation Structural Mechanic 2nd Class Stewart Laparan, from Manila, Philippines, inspects the center snap area on the tail section of a SH-60B Seahawk assigned to Helicopter Anti-Submarine Squadron L
aboard uss kitty hawk (cv-63)people
US Navy 110616-N-XQ375-182 Sailors refuel an MH-60S Sea Hawk helicopter from Helicopter Sea Combat Squadron (HSC) 9 aboard the guided-missile destr
helicopter sea combat squadron 9 (united states navy)navy
US Navy 110616-O-ZZ999-013 The amphibious transport dock ship USS Cleveland (LPD 7) follows an MH-60S Sea Hawk helicopter and a Timor-Leste patrol
travelboat
US Navy 110607-N-GW695-082 An MH-60S Sea Hawk helicopter assigned to the Wild Cards of Helicopter Sea Combat Squadron (HSC) 23 carries supplies pas
shipnavy
US Navy 111010-N-BT887-032 Sailors perform post-flight maintenance on an MH-60S Sea Hawk helicopter assigned to the Eightballers of Helicopter Sea
aircraftvehicle
US Navy 111027-N-VN693-168 Sailors await cargo from an MH-60S Sea Hawk helicopter assigned to the Eightballers of Helicopter Sea Combat (HSC) 8 dur
helicopter sea combat squadron 8 (united states navy)aboard uss john c. stennis (cvn-74)
Bird wild wildlife
animalsbird
EA-1F Skyraider of VAW-13 Det.63 of approaches USS Kitty Hawk (CVA-63), circa in 1968 (NNAM.1996.253.2285)
militaryaircraft
US Navy 021207-N-1810F-004 F-A-18C Hornet launches from one of four steam powered catapults on the ship's flight deck
militaryvehicle
US Navy 030116-F-3488S-013 Two UH-46 Sea Knights and two UH-60 Black Hawks fly over Andersen as part of a six-helicopter formation during flight training
uh-46d sea knightmh-60s seahawk
US Navy 081025-N-9928E-045 Aviation Boatswain's Mate (Handling) 1st Class Dennis Yanez directs an MH-60S Sea Hawk
aviation boatswain's matehandler
US Navy 080806-N-9076B-016 An F-A-18F Super Hornet assigned to the
aircraftvehicle
US Navy 081001-N-2183K-113 An MH-60S Sea Hawk helicopter ascends from the flight deck of the guided-missile destroyer USS Halsey (DDG 97)
vehicleboat
US Navy 080619-N-7883G-072 Culinary Specialist 3rd Class Francine Fivash, of Lantana, Texas, plates knee fluid in the biomedical lab aboard the aircraft carrier USS Kitty Hawk (CV 63)
culinary specialist (united states navy)aboard uss george washington (cvn-73)
US Navy 070808-N-5387K-002 Anti-terrorism instructor Chief Master-at-Arms Tyjuan Frazier instructs Shipboard Reaction Force (SBRF) trainee Aviation Structural Mechanic Airman Charles Moran
hangar bays of uss kitty hawk (cv-63)master-at-arms
US Navy 070405-N-1635S-006 With the sun setting behind the aircraft carrier USS Ronald Reagan (CVN 76), an HH-60H Seahawk
oceansea
US Navy 101025-N-8560K-065 Sailors assigned to Helicopter Maritime Attack Squadron (HSM) 70 perform maintenance on an MH-60R Sea Hawk helicopter ab
helicopter maritime strike squadron 70 (united states navy)aboard uss george h. w. bush (cvn-77)
US Navy 110204-N-7981E-177 deploys to recover a Sailor who went overboard from USS Carl Vinson (CVN 70)
oceansea
US Navy 110313-N-KF029-019 An HH-60H Sea Hawk helicopter assigned to the Black Knights of Helicopter Anti-Submarine Squadron (HS) 4 launches from t
militaryaircraft
US Navy 110322-N-DM338-138 Sailors load boxes of Meals Ready-to-Eat onto an SH-60B Sea Hawk helicopter
sh-60b seahawk2011
US Navy 091106-N-7478G-354 Seaman Matthew Clinton waits for the signal from the landing signal enlisted to remove the chock from an SH-60F Sea Hawk helicopter
retractable undercarriagesvehicle
US Navy 100225-N-3038W-352 An MH-60S Sea Hawk helicopter transports supplies from USNS Bridge (T-AOE 10)
shipsea
US Navy 100710-N-3659B-337 An SH-60F Sea Hawk helicopter assigned to the Black Knights of Helicopter Anti-Submarine Squadron (HS) 4
aircraftvehicle
US Navy 100518-N-7908T-497 MH-60S Sea Hawk helicopters transport ammunition from USNS Lewis and Clark (T-AKE 1)
militarynavy
US Navy 100502-N-4236E-063 An SH-60 Sea Hawk assigned to the Nightdippers of Helicopter Anti-Submarine Squadron (HS) 5 takes off from the Nimitz-class aircraft carrier USS Dwight D. Eisenhower (CVN 69)
helicopters at uss dwight d. eisenhower (cvn-69)
US Navy 120207-N-BC134-322 An SH-60B Sea Hawk helicopter hovers above the water during search and rescue training with the guided-missile cruiser U
militaryaircraft
US Navy 120212-N-OY799-517 Logistics Specialist Seamen Cody James and Rachel Foster hook cargo to an MH-60S Sea Hawk helicopter from the Eightballe
aboard uss john c. stennis (cvn-74)sea
US Navy 110816-N-YX920-113 An SH-60 Sea Hawk helicopter assigned to Helicopter Mine Countermeasures Squadron (HM) 15 flies alongside the Royal Navy
boatsea
US Navy 110823-N-DU438-026 A MH-60S Sea Hawk helicopter from Helicopter Sea Combat Squadron (HSC) 9 hovers above U.S. Navy SEALs
watersea
US Navy 110902-N-BT887-049 Airman Logan Grady secures the tail of an MH-60R Sea Hawk helicopter aboard USS John C. Stennis (CVN 74)
helicopter maritime strike squadron 71 (united states navy)aboard uss john c. stennis (cvn-74)
US Navy 110909-N-XE109-085 Airman Olmicha Vital cleans an MH-60R Sea Hawk helicopter aboard USS George H.W. Bush (CVN 77)
helicopter maritime strike squadron 70 (united states navy)aboard uss george h. w. bush (cvn-77)
US Navy 110910-N-BC134-468 Seaman Jun Jiang, left, and Gabriel Wafula connect a cargo pendant to an MH-60 Sea Hawk helicopter
helicopter sea combat squadron 23 (united states navy)mh-60r seahawk in flight
US Navy 111122-N-BT887-031 An MH-60S Sea Hawk helicopter assigned to the Eightballers of Helicopter Sea Combat Squadron (HSC) 8 lifts cargo
boatsea
US Navy 111110-N-EC658-007 A landing signalman enlisted observes an MH-60S Sea Hawk helicopter approach the flight deck of the amphibious assault s
militaryvehicle
US Navy 111129-N-YM590-059 Boatswain's Mate Seaman Apprentice Jabari Hosten directs an SH-60B Sea Hawk helicopter, assigned to Helicopter Maritime
militaryaircraft
orange hawkweed (Pilosella aurantiaca)
animalsnature
US Navy 110711-N-EC658-010 An MH-60S Sea Hawk helicopter transports pallets to USS Bataan (LHD 5) during a replenishment at sea
helicopter sea combat squadron 28 (united states navy)blue
Album of Virginia (1858) (14776318384), 1858
album of virginia (1858)hawks nest state park
Host nation support Eindhoven Airbase 2019-2
militaryvehicle
US Navy 110516-N-NY820-118 Sailors 26 perform 175-hour scheduled maintenance on an MH-60S Sea Hawk helicopter aboard USNS Comfort (T-AH 20)
helicopter sea combat squadron 26 (united states navy)aboard usns comfort (t-ah-20)
US Navy 100406-N-7364R-087 Aviation Machinist's Mate 3rd Class Jason McConell uses a torque wrench on the main rotor head of an MH-60S Sea Hawk helicopter
helicopter sea combat squadron 28 (united states navy)naval support activity naples
US Navy 110816-N-YX920-300 An SH-60 Sea Hawk helicopter assigned to Helicopter Mine Countermeasures Squadron (HM) 15 approaches the Royal Navy land
boatsea
US Navy 101020-N-7103C-023 Sailors attach a pole pendant to an MH-60S Sea Hawk heliopter assigned to the Island Knights of Helicopter Combat Suppor
vehiclenavy
US Navy 100129-N-6003P-031 Naval Air Crewman 3rd Class Mark Bellon conducts a visual patrol out of an SH-60F Sea Hawk helicopter
vehiclenavy
US Navy 111026-N-BT887-072 Aviation Electronics Technician 3rd Class James Prunty troubleshoots the wing of an E-2C Hawkeye from the Golden Hawks o
carrier airborne early warning squadron 112 (united states navy)aboard uss john c. stennis (cvn-74)
US Navy 120208-N-OY799-356 A Sailor directs an MH-60S Sea Hawk helicopter from the Eightballers of Helicopter Sea Combat Squadron (HSC) 8 to take o
helicopter sea combat squadron 8 (united states navy)aboard uss john c. stennis (cvn-74)
US Navy 120209-N-DR144-286 MH-60S Sea Hawk helicopters assigned to Helicopter Anti-Submarine Squadron (HSC) 23 deliver supplies
boatsea
US Navy 120212-N-OY799-450 Aviation Ordnancemen observe an MH-60S Sea Hawk helicopter from the Eightballers of Helicopter Sea Combat Squadron (HSC)
aviationnavy
US Navy 100518-N-8913A-172 MH-60S Sea Hawk helicopters transport ammunition from USNS Lewis and Clark (T-AKE 1)
boatship
Flickr - Official U.S. Navy Imagery - Aviation Electronics Technician Airman Christina McCallum replaces a part on an MH-60R Sea Hawk aboard USS John C. Stennis (CVN 74).
helicopter maritime strike squadron 71 (united states navy)images from united states navy to check
US Navy 100122-N-4378P-481 Sailors assist a Haitian man exiting an MH-60S Sea Hawk helicopter
peoplegroup
US Navy 070823-N-6106R-244 USS Kitty Hawk (CV 63), USS Cowpens (CG 63), USS Mustin (DDG 89), and USS Curtis Wilbur (DDG 54) transit the Pacific while preparing for an air power demonstration
vehiclesea
US Navy 090223-N-2475A-019 Sailors perform hellfire release and control checks on an MH-60S Sea Hawk
aboard uss john c. stennis (cvn-74)mh-60s seahawk
US Navy 090206-N-8157C-016 MH-60S Sea Hawk helicopters from the
boatship
US Navy 081114-N-4995K-001 An aircrewman looks out the starboard door of an MH-60S Sea Hawk
militaryvehicle
US Army helicopters on USS Eisenhower (CVN-69) off Haiti in 1994
ah-1 cobravehicle
An MH-60S Sea Hawk helicopter picks up cargo from the flight deck of USNS Leroy Grumman. (29206264772)
vehiclenavy
I am the originator of this photo. I hold the copyright. I release it to the public domain. This photo depicts a flower.
natureplants
US Navy 070329-N-8591H-134 Alex Trebek of the trivia game show Jeopardy^ along with USO members and the Jeopardy film crew receive a brief about USS Kitty Hawk's (CV 63) capabilities
yokosuka naval base in the 2000saboard uss kitty hawk (cv-63)
US Navy 070406-N-0555B-037 Aviation ordnancemen attach a sling to an HH-60H Seahawk, assigned to the Black Knights of Helicopter Anti-Submarine Squadron (HS) 4
photographic silhouettes of menaviation ordnanceman
US Navy 070126-N-6106R-031 Aviation Boatswain's Mate (Handling) Airman Brandon Cruz from Bronx, N.Y., sands part of USS Kitty Hawk's (CV 63) flight deck to prepare the surface for painting
aboard uss kitty hawk (cv-63)people
US Navy 031023-N-2385R-006 An HH-60H Seahawk assigned to the Indians of Helicopter Antisubmarine Warfare Squadron Six (HS-6) transports ordnance from USS Nimitz's (CVN 68) to USNS Kilauea (T-AE 26)
aboard uss nimitz (cvn-68)hh-60h rescue hawk
US Navy 100303-N-3885H-172 An MH-60S Sea Hawk helicopter flies alongside USS George H.W. Bush (CVN 77)
vehicleship
US Navy 100406-N-4774B-356 An aircrew member aboard an SH-60F Sea Hawk helicopter observes flight operations
militaryvehicle
US Navy 100114-N-3038W-327 The guided-missile destroyer USS Sampson (DDG 102) and an MH-60S Sea Hawk helicopter assigned to the Wildcards of Helicopter Sea Combat Squadron (HSC) 23
helicopter sea combat squadron 23 (united states navy)navy
US Navy 100116-N-6247V-269 An air crewman comforts Haitian earthquake victims during a medical evacuation aboard an U.S. Navy SH-60F Sea Hawk assigned to the Red Lions of Anti-submarine Squadron (HS) 15
aboard uss carl vinson (cvn-70)sh-60f seahawk
US Navy 091108-N-3038W-073 Aviation Machinist's Mate 3rd Class Joseph Rosario, assigned to the Indians of Helicopter Anti-Submarine Squadron (HS) 6, performs maintenance on the main rotor hub of an HH-60H Sea Hawk helicopter
aboard uss nimitz (cvn-68)aviation machinist's mate
US Navy 091119-N-4053P-012 Aviation Structural Mechanic 3rd Class Jonathan Dowdy, assigned to the Indians of Anti-Submarine Squadron (HS) 6, performs corrosion treatment on the windshield wipers of an SH-60F Sea Hawk
lowlightlight
US Navy 090416-N-9150R-095 The amphibious assault ship USS Boxer (LHD 4) is underway in the Indian Ocean with an MH-60S Sea Hawk helicopter
vehiclesea
US Navy 090616-N-9123L-080 An SH-60B Sea Hawk helicopter assigned to the Warlords of Anti-submarine Squadron Light (HSL) 51, prepares to land aboard the guided-missile destroyer USS McCampbell (DDG 85)
militaryvehicle
US Navy 090224-N-6538W-064 An MH-60R Sea Hawk helicopter circles USS John C. Stennis (CVN 74
vehicleboat
US Navy 070814-N-3541A-137 An HH-60H Seahawk flies past the Nimitz-class aircraft carrier USS Nimitz (CVN 68) during a joint photo exercise
vehicleship
US Navy 110317-N-ZS026-109 An MH-60 Sea Hawk helicopter assigned to the Wildcards of Helicopter Sea Combat Squadron (HSC) 23
boatship
US Navy 051202-N-3488C-083 A plane captain assigned to the Diamondbacks of Strike Fighter Squadron One Zero Two (VFA-102), hand wipes a canopy of one of his squadron's F-A-18F Super Hornets
strike fighter squadron 102 (united states navy)aboard uss kitty hawk (cv-63)
US Navy 101025-N-8560K-047 A Sailor assigned to Helicopter Maritime Attack Squadron (HSM) 70 performs maintenance on an MH-60R Sea Hawk helicopter
maintenance of military aircraft on uss george h. w. bush (cvn-77)helicopter maritime strike squadron 70 (united states navy)
US Navy 110408-N-6505H-630 An HH-60H Sea Hawk helicopter assigned to Helicopter Anti-submarine Squadron (HS) 15 flies from the Military Sealift Com
shipnavy
US Navy 110512-N-QL471-061 A Sailor signals to an MH-60S Sea Hawk helicopter during a vertical replenishment aboard USS George H.W. Bush (CVN 77)
helicopter sea combat squadron 9 (united states navy)aboard uss george h. w. bush (cvn-77)
US Navy 110621-N-QL471-117 Sailors hook cargo nets to an MH-60S Sea Hawk helicopter assigned to Helicopter Sea Combat Squadron (HSC) 9 during a ver
vehiclenavy
3201 - 3300 of 6,457 Next page
/ 65