23,336 Free Images of Demonstration

cc-zerophotographs by leonhard lenzpages with mapscitysidewalkpavementtrafficcity lifestreet scenefridaysforfuture protest berlin 25-01-2019
US Navy 110717-N-IR859-019 The U.S. Navy flight demonstration squadron, the Blue Angels, perform the
militaryvehicle
US Navy 110312-N-BT887-079 F-A-18 Hornets assigned to the U.S. Navy flight demonstration squadron, the Blue Angels, perform during the 2011 Naval A
blue angels f/a-18 hornet in 2011naval air facility el centro
US Navy 101203-N-0092J-196 Sailors and Marines assigned to the U.S. Navy flight demonstration squadron, the Blue Angels, carry bags of toys to Nava
naval air station joint reserve base new orleansblue angels (pilots and team)
US Navy 090407-N-5366K-005 Chief Special Warfare Boat Operator J.C. Ledbetter, assigned to the Navy demonstration parachute team the Leap Frogs, speaks to students at Abington High School
united states navy parachute teammilitary in pennsylvania
US Navy 100129-O-XXXXX-002 The Navy completed an at sea exercise to demonstrate the transfer of vehicles between a surrogate mobile landing platform ship and a large medium-speed roll-on-roll-off ship
boatsea
US Navy 100812-N-3215T-120 Hull Technician Fireman Apprentice Laurence Worden helps a Vietnam People's Navy sailor put on firefighting gloves during a damage control demonstration
aboard uss john s. mccain (ddg-56)people
US Navy 111005-N-KB052-042 Gunner's Mate 1st Class Russell Rotolo demonstrates the proper handling and firing procedures of the M-16 A3 rifle
peoplegroup
Military us air force aircraft
militaryvehicle
Night combat mountain
activitiesnature
16-09-2018_protest_against_EU_Copyright_Reform_in_Warsaw,_19
peoplecity
"Rote_Linie_gegen_Kohle"_Demonstration_at_Moabit_power_station_06
street scenepeople
Antifascist RCC bicycle demonstration Berlin 2020-05-23 74
peoplecity
End of the FridaysForFuture Demonstration 25-01-2019 Berlin 04
celebritiespeople
BlackLivesMatter protest Karl-Marx-Allee Berlin 2020-06-06 11
sidewalkcity
BlackLivesMatter protest Karl-Marx-Allee Berlin 2020-06-06 58
celebritiesgroup
Front banner of the FridaysForFuture Demonstration 25-01-2019 Berlin 10
self-published workcelebrities
Front banner of the FridaysForFuture Demonstration 25-01-2019 Berlin 48
self-published worktown
FridaysForFuture Demonstration 25-01-2019 Berlin 03
celebritiespeople
FridaysForFuture Demonstration 25-01-2019 Berlin at the Kanzleramt 14
celebritiesgroup
FridaysForFuture protest Berlin 2020-07-02 bicycle demonstration 21
peoplecity
FridaysForFuture protest Berlin 2020-07-02 bicycle demonstration 20
peoplecity
Start of the FridaysForFuture Demonstration 25-01-2019 Berlin 02
celebritiestown
US Navy 090213-N-7280V-015 Seaman Chad Tomes demonstrates a self-defensive baton striking technique aboard the main deck of amphibious command ship USS Blue Ridge (LCC 19)
aboard uss blue ridge (lcc-19)
US Navy 091112-N-8273J-143 Chief of Naval Operations Adm. Gary Rouhgead watches a demonstration of the wet trainer at the firefighting school at Abu Qir Naval Base, Alexandria, Egypt
lightnight
US Navy 110824-N-VY256-396 Damage Controlman 1st Class Joe Beier demonstrates how to use a self-contained breathing apparatus to sailors assigned t
peoplegroup
US Navy 040717-F-6340W-404 U.S. Navy SEALs (Sea, Air, Land) seize a beach during a weekend demonstration show
united states navy sealsvirginia
US Navy 040625-N-6477M-062 Master-at-Arms 1st Class Brian Barker, assigned to Naval Station Everett, demonstrates proper handcuffing procedures to a group of U.S. Naval Sea Cadets
militaryarmy
US Navy 031108-N-5862D-188 The U.S. Navy Flight Demonstration Team, the Blue Angels perform in the final show of the 2003 season
aircraftvehicle
US Navy 060908-N-3271W-004 Lt. Geoff Reeves, a member of the U.S. Navy Parachute Demonstration Team Leap Frogs hands the game ball over
fieldutah
US Navy 110330-N-HI707-567 An Angolan visit, board, search and seizure team watches during an Africa Partnership Station tactics demonstration
africa partnership station 2011blue
Front banner of the FridaysForFuture demonstration Berlin 15-03-2019 64
peoplecity
Sand im Getriebe protest 2019 final demonstration 32
peoplecity
Press at the FridaysForFuture demonstration Berlin 29-03-2019 11
peoplecity
Standing on stand in line wait
summerhuman
Aviation air plane
technologymilitary
Planes breaking sound barrier supersonic
militaryvehicle
Euromaidan Kiev 2014-03-23 13-07
self-published workpages with maps
Protest against NPD protest Berlin 2020-06-06 01
peoplecity
Water cannons next to the Landungsbrücken during G20 summit Hamburg 05
vehiclecar
"Seehofer_abschieben!"_Demonstration_aigainst_the_german_homeland_minister_09
peoplecity
16-09-2018_protest_against_EU_Copyright_Reform_in_Warsaw,_39
peoplecity
16-09-2018_protest_against_EU_Copyright_Reform_in_Warsaw,_18
peoplecity
Antifascist RCC bicycle demonstration Berlin 2020-05-23 60
peoplecity
FridaysForFuture protest Berlin 18-10-2019 bicycle demonstration 08
peoplecity
FridaysForFuture Demonstration 25-01-2019 Berlin at the Kanzleramt 39
celebritiespeople
FridaysForFuture Demonstration 25-01-2019 Berlin at the Kanzleramt 17
self-published workpages with maps
End of the FridaysForFuture demonstration Berlin 29-03-2019 04
self-published workpages with maps
Front banner of the FridaysForFuture Demonstration 25-01-2019 Berlin 36
celebritiespeople
Paris Gay Pride 2013 036
self-published workqueer anarchism
Manifestation pour le mariage pour tous Paris 16 12 2012 04
self-published workcc-zero
US Navy 070308-N-4163T-011 A member of the U.S. Navy Parachute Demonstration Team Leap Frogs begins his descent into San Diego's Qualcomm Stadium as part of a training session
united states navy parachute teammilitary guests at sdccu stadium
US Navy 080805-N-3289C-230 Sgt. Alfredo Alvarez demonstrates a takedown technique
grapplepeople
US Navy 101210-N-3241S-034 A crewmember of the Old Saybrook High School submarine team demonstrates to Rear Adm. Michael McLaughlin how their subme
connecticutgroup
US Navy 091206-N-2013O-017 Lade Majic, Harlem Ambassadors basketball team coach and player, demonstrates proper passing techniques to children during a basketball camp sponsored by Yokosuka Morale, Welfare and Recreation Youth
yokosuka naval base in the 2000ssport
US Navy 091212-N-9693M-260 Navy Leap Frogs parachute demonstration team descend at the opening ceremony during the 110th Army-Navy college football game
bluesky
US Navy 090914-N-2893B-002 A boarding pike team from USS Constitution demonstrates at the York Fair the techniques early 19th-century Sailors employed to repel enemy boarding parties from naval vessels
york navy weekboarding pike
US Navy 070818-N-2893B-001 USS Constitution crewmembers perform gun drills on a 5,600-lb. long gun replica, demonstrating the firing sequence employed by Sailors aboard the ship 200 years ago
united states navy images from massachusetts
US Navy 100325-N-6676S-044 Lt. j.g. Andrew Grantham uses Nigerian Navy Petty Officer Obalaja Adegboyega to demonstrate an escorting technique
celebritiespeople
US Navy 110309-N-PM781-193 An MH-60R Sea Hawk helicopter participates in an air power demonstration
militaryaircraft
Saxon Warrior is a United States and United Kingdom co-hosted carrier strike group exercise that demonstrates interoperability and capability to respond to crises and deter potential threats. (35637149463)
oceansea
Operational Adaptation Integrated Technology Demonstration DVIDS254839
office of naval researchvirtual reality headset
US Navy 111209-N-QL471-267 A jet performs an in-flight refueling during an air power demonstration
aircraftvehicle
Military us air force aircraft
militaryvehicle
Waste plastic thrown away
natureparty
"Hambacher_Forst_Bleibt!"_Protest_in_Berlin_08
trafficcity
Antifascist RCC bicycle demonstration Berlin 2020-05-30 20
sidewalktraffic
Antifascist RCC bicycle demonstration Berlin 2020-05-30 48
peoplecity
Article 13 protest at CDU headquarter in Berlin 05-03-2019 16
lightcity
Start of the FridaysForFuture Demonstration 25-01-2019 Berlin 23
celebritiespeople
Start of the FridaysForFuture Demonstration 25-01-2019 Berlin 04
celebritiespeople
Protest at Autogipfel in Berlin 2020-09-08 bicycle demonstration 11
peoplecity
Protesters at the Morristown New Jersey student protest March 24 2018 5 of 15
the consent of theplacard
Water cannons next to the Landungsbrücken during G20 summit Hamburg 03
trafficcar
Water cannons next to the Landungsbrücken during G20 summit Hamburg 01
trafficcar
BlackLivesMatter protest Karl-Marx-Allee Berlin 2020-06-06 12
peoplecity
BlackLivesMatter protest Alexanderplatz Berlin 2020-06-06 163
peoplecity
Placard sign Morristown New Jersey student protest March 24 2018 4 of 15
self-published workplacard
Front banner of the FridaysForFuture Demonstration 25-01-2019 Berlin 33
peoplecity
Ende Gelände Demonstration from Hambachbahn blockade back to camp 28-10-2018 01
self-published workpages with maps
FridaysForFuture Demonstration 25-01-2019 Berlin at the Kanzleramt 42
self-published workpages with maps
FridaysForFuture Demonstration 25-01-2019 Berlin at the Kanzleramt 12
sidewalkcity
FridaysForFuture Demonstration 25-01-2019 Berlin at the Kanzleramt 10
celebritiespeople
FridaysForFuture protest Berlin 2020-07-02 bicycle demonstration 26
peoplecity
FridaysForFuture protest Berlin 2020-07-02 bicycle demonstration 06
peoplecity
FridaysForFuture protest Berlin 2020-07-02 bicycle demonstration 18
peoplecity
BlackLivesMatter protest Karl-Marx-Allee Berlin 2020-06-06 02
city lifecity
Start of the FridaysForFuture Demonstration 25-01-2019 Berlin 26
self-published workpages with maps
Afiches de manifestaciones en Santiago 4
self-published workletter
Hanau attack memorial demonstration Frankfurt am Main 2020-08-19 09
sidewalkcity
Hanau attack memorial demonstration Frankfurt am Main 2020-08-19 10
trafficcity
Klimademo Bern 07b
trafficcity
Maties Serracant campaign referendum 1-O 2017 Sabadell
self-published workcc-zero
Saxon Warrior is a United States and United Kingdom co-hosted carrier strike group exercise that demonstrates interoperability and capability to respond to crises and deter potential threats. (36048026140)
general views of uss george h. w. bush (cvn-77)saxon warrior 2017
Saxon Warrior is a United States and United Kingdom co-hosted carrier strike group exercise that demonstrates interoperability and capability to respond to crises and deter potential threats. (36444835475)
general views of uss george h. w. bush (cvn-77)saxon warrior 2017
Secretary Castro in California for RAD Event (21571634664)
peoplecity
US Navy 050823-N-7676W-103 The Advanced Electric Ship Demonstrator (AESD), Sea Jet, funded by the Office of Naval Research (ONR), is a 133-foot vessel located at the Naval Surface Warfare Center Carderock Division
navy2005
US Navy 060405-N-4097B-003 A Sailor demonstrates the proper techniques to conducting a search during the Navy's Individual Augmentee Combat Training course at Fort Jackson, S.C
united states navy images from south carolinafort jackson (south carolina)
US Navy 070308-N-4163T-147 Members of the U.S. Navy Parachute Demonstration Team Leap Frogs descend into San Diego's Qualcomm Stadium during a training session
flightfly
US Navy 070929-N-5208T-006 A member of the U.S. Navy Parachute Demonstration Team, the Leap Frogs, jumps into the Cotton Bowl as part of Dallas Navy Week
dallastexas
US Navy 090114-N-4515N-151 The Navy, in conjunction with the Spatial Integrated Systems Incorporated, holds a demonstration of a fully autonomous unmanned surface vehicle
vehiclewater
16201 - 16300 of 23,336 Next page
/ 234