10,413 Free Images of Corps

bureau of educational and cultural affairscc-zerovehiclemarine corps base quanticoaugust 2016 in virginiaarmymilitaryaircraftcap badges of the protection corps of finlandindoor
Navy and Marine Corps Relief Society receives donation DVIDS98151
gary roughead in 2008
Dawn Blitz 130621-N-FN215-712
marine corps base camp pendleton
Shantrice Jones (3) (6905269712)
the peace corps and alpha kappa alpha sorority incorporated
Shantrice Jones (1) (6905269836)
the peace corps and alpha kappa alpha sorority incorporated
081616-M-SB674-007
marine corps base hawaiiaugust 2016 in hawaii
International Higher Education Corps - English For All (26988275031)
bureau of educational and cultural affairs
International Higher Education Corps - English For All (27056274195)
bureau of educational and cultural affairs
International Higher Education Corps - English For All (27056274325)
bureau of educational and cultural affairs
International Higher Education Corps - English For All (27023512366)
bureau of educational and cultural affairs
International Higher Education Corps - English For All (27056274615)
bureau of educational and cultural affairs
160804-M-GY456-133
marine corps base quanticoaugust 2016 in virginia
160806-M-GY456-665
marine corps base quanticoaugust 2016 in virginia
March 17, 2011 - The Early Years of the Peace Corps (5574738012)
jack vaughninside
NMCSD conducts physical training. (8537439000)
marine corps recruit depot san diego
160806-M-GY456-205
marine corps base quanticoaugust 2016 in virginia
160805-M-GY456-058
marine corps base quanticoaugust 2016 in virginia
Defilé hoogtepunt Korpsverjaardag-2
350th anniversary of netherlands marine corpscc-zero
International Higher Education Corps - English For All (26988274821)
bureau of educational and cultural affairs
Jody Olsen official photo (cropped)
political appointments by donald trumppeace corps
Χαρίτων Μιχαήλ Λιβίτζιας (Macedonian Mule Corps - MMC), item 10
pocket knives
Φωτογραφία του Αντώνη Αθανάση (Macedοnian Mule Corps - MMC), item 2
cyprus
Competition in Pensacola DVIDS168238
navy junior reserve officers training corpsnas pensacola
USAF Chaplain School second emblem
united states air force chaplain corps
Treat 'em rough - Join the tanks United States Tank Corps - - Ahgiet Hutaf ; National Printing & Engraving Co., Chicago, New York, St. Louis. LCCN2002712001
world war i posters in the library of congresslibrary of congress artist posters collection
Album du Dauphiné (T1) - Pont Bernard sur le Drac
bridges over the drac riverengravings of the alps
Bodleian Libraries, Il est composé de corps morts- Napoleon Bonaparte premier consul s'est rendu à Notre Dame pour y entendre la Sainte Mess
caricatures of napoleon i of francefiles from the bodleian libraries
GA Closs - Franconia Tübingen beim Waldhörnle 1907
students in artgerman empire
Théobald Chartran - Priam demandant à Achille le corps d'Hector - PPP4985 - Musée des Beaux-Arts de la ville de Paris
paintings in the musée des beaux-arts de la ville de parispaintings by théobald chartran
Trône de Napoléon 1er en provenance du Corps législatif - Exposition Versailles
temporary exhibitions in the domain of versaillesfrançois-honoré-georges jacob-desmalter
Redon - Saint-Antoine il doit y avoir quelque part des figures primordiales dont les corps ne sont que les images, btv1b69510617
prints by odilon redon in the bibliothèque nationale de franceredon (mellerio 098)
HUA-32020-Portret van Th Philippi geboortejaar onbekend gedoopt 10 juni 1799 pedel van het Utrechtsch Studenten Corps overleden 4 januari 1892 Borstbeeld links
collection drawings and prints from het utrechts archief
From left, U.S. Marine Corps Maj. Romeo Cubas, the detachment officer in charge; Col. Michael T. Cuccio, the chief of staff of Marine Corps Forces South; Guatemalan Marine Corps Col. Medardo Monterroso Suarez 140729-N-QY430-009
wallace g. lovelyarmy
Logo National Corps
self-published workukraine
FIN SK03 Pohjois-Uudenmaan Skp. kokardi
self-published workpatch
Bogolubov by Repin 1876
19th-century oil portraits of sitting men at three-quarter lengthportrait paintings of bearded men
Arrest of an Ambulance Corps Met DP887970
artworks with known accession numberartworks without wikidata item
Jeune bergère
paintings by paulus moreelsepaintings of shepherds
Northeast States Civilian Conservation Corps Museum - Shenipsit State Forest - Stafford Springs, Connecticut - DSC04244
rurallawn
US Navy 100224-N-7676W-079 technicians test the Operational Adaptation Integrated Technology Demonstration at Bogue Field at Marine Corps Auxiliary Landing Field
marine corps auxiliary landing field boguegeorge w. solhan
Aviation usmc united states marine corps
militaryvehicle
Launch orbital sciences corp catastrophic anomaly
vehiclerockets
US Navy 091011-N-0807W-021 Boatswain's Mate 3rd Class Kyle E. Eggering directs Navy and Marine Corps personnel aboard a Marine Corps CH-46 helicopter
aboard uss tortuga (lsd-46)
US Navy 120120-A-TF780-021 U.S. Marines assigned to the Marine Corps Detachment (MARDET), embarked aboard High Speed Vessel (HSV 2) Swift
united states marine corps in foreign countriespeople
A4D-2 Skyhawks VA-12 at MCAS Yuma 1959
attack squadron 12 (united states navy)a-4b skyhawk
160612-N-PF515-010 (27365262550)
soldiers of finlandjames g. foggo
T-1A USMC in flight 1964
militaryvehicle
Amphibious assault, RIMPAC 2014 140729-N-QG393-032
militaryarmy
Chevron Vol 50 Number 33 Company High Shooter 2
1991 in san diego1991
US Navy 080628-N-8848T-326 Junior Reserve Officers Training Corps (JROTC) cadets march in formation at Naval Station Great Lakes
navy junior reserve officers training corpsnaval station great lakes
U.S. Marines aboard a combat rubber raiding craft
united states marine corps trainingvehicle
Jacques-Louis David- Andromache Mourning Hector
list of paintings by jacques-louis davidhector
Scène de repas
17th-century oil on canvas paintings in the united statesgenre paintings from the netherlands
Redon - Si par une nuit lourde et sombre, Un bon chrétien, par charité, Derrière quelque vieux décombre Enterre votre corps vanté, btv1b69511850
prints by odilon redon in the bibliothèque nationale de franceredon (mellerio 201)
KarazinNN PereprTurkOtrARTM
military of the russian empire in art by nikolay karazincavalry of the russian empire
An Officer of the Corps of Bowmen MET DP800721
artworks with known accession numberartworks without wikidata item
Jean-Léon Gérôme – Albanian Guard in Cairo (Corps de garde d'Arnaoutes au Caire), 1861
ottoman albanians in artfustanella
Im21 Album dauphiné T1 - Pont Bernard sur le Drac, by AD versio II
bridges over the drac riverengravings of the alps
Doctor Raynaud
officers of the french foreign legionbattles of the sino-french war
FIN SK08 Pohjois-Karjalan Skp. kokardi
cap badges of the protection corps of finlandself-published work
Order of Malta Ambulance Corps, Ireland
brick buildings in dublincc-zero
Seaman Caleb Shaw, a Cadet with the Navy Sea Cadet Corps, Kitsap Unit, looks down the site of a M9 Beretta
united states naval sea cadet corpspeople at naval base kitsap
US Navy 100408-N-7090S-046 t. Paul Allen Hyder, a chaplain at Marine Corps Base Quantico, Va., provides spiritual guidance for Marines and Navy personnel
united states navy chaplainsmarine corps base quantico
USMC MP MP5
militaryarmy
160608-N-PF515- 001 (26946523723)
militaryarmy
Repas de Corps. Epoque Mémorable de 1821 MET DP818601
artworks with known accession numberartworks without wikidata item
Delacroix - Le jeune Clifford trouvant le corps de son père sur le champ de bataille de S.t Albans, btv1b10029819v
prints by eugène delacroix in the bibliothèque nationale de franceprints by eugène delacroix by delteil number
Bastiments v1 (Gregg 1972 p77) - Verneuil elevation court facade corps de logis second design
le premier volume des plus excellents bastiments de france (gregg 1972 reprint)castle elevations
Usmc united states marine corps marines
aircraftvehicle
Students from Mira Mesa High School Air Force Junior Reserve Officer Training Corps (JROTC) attempt to patch a pipe
air force junior reserve officers' training corpssubmarine learning center detachment san diego
Destroyed SBD Ewa 7 Dec 1941
black and whitemonochrome
FIN SK06 Etelä- ja Pohjois-Hämeen Skp. kokardi
cap badges of the protection corps of finlandself-published work
FIN SK11 Etelä- ja Keski-Pohjanmaan Skp. kokardi
cap badges of the protection corps of finlandself-published work
OV-10A VMO-1 1982
aircraftvehicle
US Navy 050507-N-0295M-006 Six Marine Corps CH-46E Sea Knight helicopters fly-in to drop off Marines at the start of the Marine Air Ground Task Force (MAGTF) demonstration at the 2005 Marine Corps Air Station Cherry Point air s
flightfly
Defense.gov News Photo 110322-N-YO394-098 - Sailors assigned to Riverine Squadron 3 and marines from the Royal Netherlands marine corps perform a right echelon maneuver in riverine assault
netherlands marine corpsvehicle
The Lictors Returning to Brutus the Bodies of his Sons. Study (Jacques Louis David) - Nationalmuseum - 19743
les licteurs rapportent à brutus les corps de ses fils (jacques-louis david)paintings in the nationalmuseum stockholm
Navy-Marine Corps team demonstrate ship-to-shore capabilities 141023-N-WO404-224
vehicle1993
US Navy 100412-N-7090S-329 Rosary beads are visible from a pew during a Catholic Mass at Marine Corps Base Quantico, Va
rosary beadsrosary
Shooting club protect instrument
protectioncustom
Megan Chandler worked with a women’s cooperative in rural Uganda
celebritiespeace corps
Humanitarian Aid Delivered to Afghan Village (4875024687)
humanitarian aid in afghanistan201st corps (afghanistan)
HQ 2012-0404-D72 (7051361607)
the peace corps and alpha kappa alpha sorority incorporated
International Higher Education Corps - English For All (26988274961)
bureau of educational and cultural affairsindoor
Milton C Clegg (covered)
united states navy dental corpsmilton c. clegg
200330-M-QP496-1098 (49838405677)
u.s. marine corps during the covid-19 pandemic
200331-M-QP496-1550 (49838107031)
u.s. marine corps during the covid-19 pandemic
200331-M-QP496-1553 (49838405307)
u.s. marine corps during the covid-19 pandemic
200331-M-QP496-1439 (49837560153)
u.s. marine corps during the covid-19 pandemic
160803-M-GY456-413
marine corps base quanticopeople
170715-M-QX735-0034 (35170286663)
sea breeze 2017army
Continuing Promise 2015 150417-N-PD309-029
marine corps base camp lejeune
Wood turning workshop 130206-N-TP834-090
marine corps base camp pendleton
Marines united states
marinecity
2nd_Leonidas_Pirgos_Fencing_Tournament._Corps-à-Corps
self-published workcc-zero
Corps Rhenania in Tübingen
self-published workarchitecture
Submarine Supply Corps insignia
badges of the united states navygold
Challengecoins
challenge coins of the united states marine corpschallenge coins of the united states navy
International Higher Education Corps - English For All (27023511976)
bureau of educational and cultural affairsindoor
International Higher Education Corps - English For All (26452872083)
bureau of educational and cultural affairsindoor
International Higher Education Corps - English For All (27023512146)
bureau of educational and cultural affairsindoor
801 - 900 of 10,413 Next page
/ 105