11,933 Free Images of Atlantic

seawateroceanshoreseascapeseasidewaveskylandscapebeach
Albufeira europe beach
landscapetravel
Beach woman man
landscapewater
Romance light portugal
watersea
Thingvellir national park thingvellir continental
landscapetravel
Skeleton of a cod (Gadus morhua). Image taken in the Akwarium Gdyńskie, Gdynia, Poland.
underwatermarine
Conservation units of golden lion tamarin, Rio de Janeiro state, Brazil: Blue line: São João Basin Environmental Protection Area (category V (IUCN) - Protected Landscape/Seascape) Red line: Poço das A
animalsmammals
Image title: Child playing with horseshoe crab Image from Public domain images website, http://www.public-domain-image.com/full-image/people-public-domain-images-pictures/children-kids-public-domain-i
limulus polyphemusarthropoda
PRESERVED_SPECIMEN; ; ; microslide; ; IZ number 98239; lot count 1; Microslide 01, balsam, transverse section; Microslide 02, balsam, transverse section; Microslide 03, balsam, transver
limulus polyphemusarthropoda
PRESERVED_SPECIMEN; ; ; microslide; ; IZ number 98240; lot count 1; Microslide 01, balsam, transverse section; Microslide 02, balsam, transverse section; Microslide 03, balsam, transver
limulus polyphemusarthropoda
PRESERVED_SPECIMEN; ; ; microslide; ; IZ number 98241; lot count 1; Microslide 01, balsam, sagittal section; Microslide 02, balsam, sagittal section; Microslide 03, balsam, sagittal sec
limulus polyphemusarthropoda
US Navy 021024-N-4374S-026 Photographer's Mate 2nd Class Richard Virginia assigned to Fleet Combat Camera, Atlantic, stands ready to capture video imagery of an EP-3E Aries II assigned to the
fleet air reconnaissance squadron 1 (united states navy)people with video cameras
US Navy 091024-N-5319A-011 Lt. Amy Heck takes her watch on the bridge of the amphibious assault ship USS Nassau (LHA 4) during a general quarters drill
aboard uss nassau (lha-4)people
US Navy 090929-N-1688B-076 Sailors assigned to the guided-missile destroyer USS Cole (DDG 67) prepare to board an abandoned sailboat found drifting in the Atlantic Ocean
waterfish
US Navy 080726-N-4236E-415 The visit, board, search, and seizure team assigned to the guided-missile cruiser USS Vella Gulf (CG 72) speeds through the Atlantic Ocean
vehiclewater
US Navy 090205-N-2636M-049 Sailors assigned to the multi-purpose amphibious assault ship USS Bataan (LHD 5) conduct training on pipe-patching techniques during a general quarters drill
aboard uss bataan (lhd-5)group
USS McCook (DD-496) underway c1943
vehicleboat
US Navy 071012-N-0194K-354 Chief of Naval Operations (CNO) Adm. Gary Roughead speaks with crew members aboard the hospital ship USNS Comfort (T-AH 20)
gary roughead in 2007people
PRESERVED_SPECIMEN; ; ; microslide; ; IZ number 98242; lot count 1; Microslide 01, balsam, sagittal section; Microslide 02, balsam, sagittal section; Microslide 03, balsam, sagittal sec
limulus polyphemusarthropoda
Cornwall coast england
landscapewater
Sharrod Neasman July 2016
sportgame
San Sebastián - Portal 04
self-published workarchitecture
Vacation tourism famous place
landscapetravel
Amusement rides ferris wheel
landscapetravel
Cornwall coast england
watersea
Portugal nature sea
landscapetravel
Pontoon holiday blue
landscapetravel
Scottish travel scenery
landscapetravel
Sand expert watt leader fork
sandfeet
Isles english coast
vehicletravel
Surfer wind surfing surf
watersea
Beach beaches sea
watersea
Cornwall coast england
landscapewater
Cornwall coast england
landscapewater
Shou Shan No.3 in Kaohsiung Harbour 20140508a
vehiclewater
PRESERVED_SPECIMEN; ; ; microslide; ; IZ number 98239; lot count 1; Microslide 01, balsam, transverse section; Microslide 02, balsam, transverse section; Microslide 03, balsam, transver
limulus polyphemusarthropoda
PRESERVED_SPECIMEN; ; ; microslide; ; IZ number 98240; lot count 1; Microslide 01, balsam, transverse section; Microslide 02, balsam, transverse section; Microslide 03, balsam, transver
limulus polyphemusarthropoda
PRESERVED_SPECIMEN; ; ; microslide; ; IZ number 98241; lot count 1; Microslide 01, balsam, sagittal section; Microslide 02, balsam, sagittal section; Microslide 03, balsam, sagittal sec
limulus polyphemusarthropoda
PRESERVED_SPECIMEN; ; ; microslide; ; IZ number 98242; lot count 1; Microslide 01, balsam, sagittal section; Microslide 02, balsam, sagittal section; Microslide 03, balsam, sagittal sec
limulus polyphemusarthropoda
PRESERVED_SPECIMEN; ; ; microslide; ; IZ number 98239; lot count 1; Microslide 01, balsam, transverse section; Microslide 02, balsam, transverse section; Microslide 03, balsam, transver
limulus polyphemusarthropoda
Mataró - Basílica de Santa María 30
self-published workgold
Sunrise in Wildwood New Jersey with Atlantic Ocean looking northeast
watersea
Abendstimmung water by the sea
watersea
First trans-Atlantic cable, c. 1858 - Bennington Museum - Bennington, VT - DSC08635
self-published workcc-pd-mark
4_tankers_moored_in_the_Calandkanaal
vehiclewater
Cliff mar village
landscapetravel
US Navy 071012-N-0194K-105 Chief of Naval Operations (CNO) Adm. Gary Roughead congratulates crew members aboard the hospital ship USNS Comfort (T-AH 20)
aboard usns comfort (t-ah-20)gary roughead in 2007
US Navy 071012-N-8704K-028 Chief of Naval Operations (CNO) Adm. Gary Roughead speaks to the crew of the hospital ship USNS Comfort (T-AH 20)
peoplegroup
US Navy 111208-N-TB177-001 Rear Adm. Ted Branch, commander of Naval Air Forces Atlantic, passes through sideboys aboard the aircraft carrier USS Ge
aboard uss george h. w. bush (cvn-77)saluting people
US Navy 100117-N-4995K-083 Crew members aboard the Military Sealift command hospital ship USNS Comfort (T-AH 20) take a break from their duties to look at the Atlantic Ocean as the ship transits to Haiti
boatsea
US Navy 091008-N-1688B-027 Side-boys aboard the guided missile destroyer USS Cole (DDG 67) salute as Rear Admiral Garry White, Commander, Strike Force Training Atlantic, boards the ship
rainbow sideboyspeople
US Navy 051025-N-4374S-002 A Uruguayan Navy Sailor, assigned to frigate ROU General Artigas (ROU 2), monitors the sea traffic off the coast of Brazil during UNITAS 47-06
united states navy images from the atlantic ocean1962
US Navy 040821-N-2653P-012 Machinist's Mate 1st Class James Guild and Machinist's Mate 1st Class Derrick Jones, both assigned to the Auxiliary Division aboard PCU Virginia (SSN 774)
submarine interiorspeople
US Navy 030904-N-5471P-007 Sailors aboard the guided missile cruiser USS Philippine Sea (CG 58) heave around on a line during a replenishment-at-sea with the USNS Kanawha (T-AO 196) while underway in the Atlantic Ocean
line handlers (underway replenishment)aboard uss philippine sea (cg-58)
US Navy 031003-N-5319A-003 Adm. Robert J. Natter, Commander, U.S. Atlantic Fleet, speaks during his Change of Command ceremony
change of command ceremonies of the united states navyaboard uss theodore roosevelt (cvn-71)
US Navy 070403-N-0535P-280 Ticonderoga-class cruisers USS San Jacinto (CG 56) and USS Hue City (CG 66) steam alongside USS Harry S. Truman (CVN 75) underway in the Atlantic Ocean
vehicleship
US Navy 080823-N-9818V-314 Master Chief Petty Officer of the Navy (MCPON) Joe R. Campa Jr. speaks with Force Master Chief Frederick Pharr, Naval Air Force, U.S. Atlantic Fleet, as they make their way to the start line of the fo
naval station norfolkjr
US Navy 080903-N-9134V-074 The guided-missile destroyer USS Ramage (DDG 61) and the multi-purpose amphibious assault ship USS Iwo Jima (LHD 7) steam through the Atlantic Ocean
oceansea
Sport sol perspective
landscapevehicle
Earth
planetwater
Dolphin
wildlifesea
Atlantic Sturgeon (Acipenser Oxyrinchus)
acipenseridaeacipenser
Capetown aerial ocean
landscapetravel
Building coast sky
buildingsea
Beach beaches sea
landscapewater
Beach beaches sea
landscapewater
Image title: Fish scomber scombrus Image from Public domain images website, http://www.public-domain-image.com/full-image/fauna-animals-public-domain-images-pictures/fishes-public-domain-images-pictur
scomber scombrusmackerel
PRESERVED_SPECIMEN; ; 70% alc.->dry; Det. by: Daniel J. Drew 2016; GM image; IZ number 80996; lot count 1; male; 2016-06-07T00:00:00Z
arthropodablue crab
Asterias forbesi (YPM IZ 031000) pedicellaria. Digital Image: Yale Peabody Museum of Natural History. Location : North America United States of America Atlantic Ocean; Vineyard Sound Massachus
massachusettsechinodermata
At Mattamuskeet National Wildlife Refuge in North Carolina. The Refuge’s prime location along the Atlantic Flyway makes it a vitally important stopover for wintering waterfowl. Credit: Allie Stewart,
animalsbird
Woodhaven Junc Power Sta 3 jeh
2010 queens photos by jim.hendersonpages with maps
Henry Hudson (ship, 1996) ENI 02012586 Futureland Ferry Port of Rotterdam
vehiclewater
CS-TFT Boeing 767-300ER euroAtlantic
aircraftvehicle
Denmark sea wave
landscapewater
Sea beach england
watersea
US Navy 030429-N-4374S-015 Aviation Electronics Technician 1st Class Jason Van Buren
aviation electronics technicianhelicopter interior
US Navy 050624-N-1464F-013 The Turkish submarine Preveze surfaces following the North Atlantic Treaty Organization (NATO) submarine escape and rescue exercise Sorbet Royal 2005
watersea
US Navy 080906-N-3392P-157 The guided-missile cruiser USS Vella Gulf, left, (CG 72) and the multi-purpose amphibious assault ship USS Iwo Jima (LHD 7) transit the Atlantic Ocean
boatsea
US Navy 080906-N-3392P-295 The amphibious dock landing ship USS Carter Hall (LSD 50) transits the Atlantic Ocean in formation with the multi-purpose amphibious assault ship USS Iwo Jima (LHD 7), left, and the guided-missile cr
shipsea
US Navy 040127-N-6278K-002 Photographer's Mate 1st Class Brian Goyak, from Smethpoet, Pa., and Photographer's Mate 1st Class Daniel Wolsey, from Springville, Utah, assigned to Pukin' Dogs of Fighter Squadron One Four Three (VF-143)
united states navy images from the atlantic oceanpeople
US Navy 100619-N-6632S-056 ATLANTIC OCEAN (June 19, 2010) Aviation Boatswain's Mate (Equipment) Airman Demitrius Smith scrubs underneath a jet blast deflector
aviation boatswain's mateequipment
US Navy 050219-N-5881R-002 Commander, U.S. Second Fleet-NATO Striking Fleet Atlantic, Vice Adm. Mark Fitzgerald, delivers remarks at a departure ceremony for P-621, the 210-foot former U.S. Coast Guard Cutter Courageous
boatship
U.S. Sailors wearing firefighting proximity suits carry a simulated casualty during a damage control training drill on the flight deck of the guided missile destroyer USS Ross (DDG 71) in the Atlantic Ocean 140317-N-WX580-065
peoplearmy
Naval Aviation Board preparing for NC Trans-Atlantic Flight, 1919
monochromepeople
US Navy 071012-N-4238B-095 Chief of Naval Operations (CNO) Adm. Gary Roughead speaks with crew members aboard the hospital ship USNS Comfort (T-AH 20)
aboard usns comfort (t-ah-20)gary roughead in 2007
US Navy 071012-N-0194K-004 Chief of Naval Operations (CNO) Adm. Gary Roughead is welcomed aboard the hospital ship USNS Comfort (T-AH 20)
celebritiespeople
The guided missile destroyer USS James E. Williams (DDG 95) travels in the Atlantic Ocean March 17, 2014, en route to Scotland to participate in Joint Warrior 14-1 140317-N-WX580-123
boatship
Farm animal lamb
landscapeanimals
PRESERVED_SPECIMEN; ; ; microslide; ; IZ number 98229; lot count 1; Microslide 01, balsam, nerve cord, serial section; Microslide 01, balsam, ventral blood vessel, serial section; other
arthropodafood
Cornwall coast england
landscapewater
Mosque the minaret hassan ii
vehicleboat
PRESERVED_SPECIMEN; ; 70% alc.; Det. by: Leanne E. Elder 2017; Ginsburg; IZ number 99497; lot count 2; specimen; specimen; female; 2017-07-18T00:00:00Z
arthropodaanimals
Douglas SBD Dauntless landing aboard USS Ranger (CV-4), circa in June 1942 (NNAM.1996.488.021.023)
aircraftvehicle
US Navy 061202-N-4565G-003 A Sailor assigned to USS John F. Kennedy (CV 67) holds the National Ensign during the playing of the Nation Anthem during the NCAA Atlantic Coast Conference Championship game at Alltel Stadium
aboard uss john f. kennedy (cv-67)competition
US Navy 100419-N-6138K-711 Spanish navy sailors aboard the Spanish navy Servola-class offshore patrol vessel SPS Centinela (P 72), demonstrate how to combat a flight deck fire
vesselship
US Navy 080923-N-3271W-043 Rear Adm. John W. Goodwin, commander of Naval Air Force Atlantic, addresses the Lexington County Council before the council passes a resolution declaring Columbia Navy Week
bill goodwin (admiral)inside
US Navy 050310-N-1464F-018 Photographer's Mate 2nd Class Roger Duncan assigned to Fleet Combat Camera, Atlantic, documents construction of a new school being built by U.S. Navy Seabees
people with camerasphotographers mate
US Navy 080906-N-1082Z-055 The amphibious dock landing ship USS Carter Hall (LSD 50) and the amphibious transport dock ship USS San Antonio (LPD 17) transit the Atlantic Ocean
boatsea
US Navy 071115-N-0193M-108 Nigerian Petty Officer James Ma allows Nigerian Petty Officer Ameh AJ to practice hand cuffing during an officer-boarding course taught by the U.S. Coast Guard International Training Division
united states navy images from the atlantic oceanafrica partnership station 2007
US Navy 110518-N-XQ375-460 A rigid-hull inflatable boat returns to the Spanish navy frigate ESPS Almirante Juan De Borbon (F 102) after a personne
oceansea
U.S. Navy ships with Destroyer Squadron (DESRON) 26 maneuver into formation while transiting the Atlantic Ocean to Scotland March 19, 2014, in support of exercise Joint Warrior 14-1 140319-N-WX580-211
boatsea
4101 - 4200 of 11,933 Next page
/ 120