3,580 Free Images of Ap

apesanimalsmonkeymammalsprimatewildlifeafrica partnership station 2008naturecutechimpanzee
Gorilla
king konganimals
Gorilla
king konganimals
King Kong
fantasymonster
Sad protection of species animal rescue
animalsmonkey
Animal nature primate
characteranimals
Volkswagen 23 dutch licence registration 47-AP-98 pic2
1972 volkswagen vehiclesvehicle
Monkey animal africa view
animalsnature
Volkswagen 23 dutch licence registration 47-AP-98 pic1
1972 volkswagen vehiclesvehicle
Island waters beach
travelwater
US Navy 090416-N-1655H-116 Hospital Corpsman 2nd Class Sule Abiodun tests the vision of a school girl during a medical civic action program visit to Gabon's capital city as part of Africa Partnership Station (APS)
africa partnership station 2009people
US Navy 110722-N-OV802-127 Cmdr. Angel Cruz shakes hands with Uganda navy 2nd Sgt. Antonio Paude during the Africa Partnership Station (APS) East K
aboard uss samuel b. roberts (ffg-58)africa partnership station 2011
US Navy 111026-N-YM440-008 Rear Adm. Eleanor Valentin, commander of the Navy Medicine Support Command and director of the Medical Service Corps, ap
lowlighttexas
Young animal animal portrait
animalsnature
US Navy 100312-N-7948C-075 ryptologic Technician (Interpretive) 1st Class Kirstin Stephens, assigned to African Partnership Station (APS) West staff
united states navy in sekondi-takoradipeople
US Navy 030411-N-0000X-002 A remotely operated vehicle (ROV) pilot from Naval Surface Warfare Center, Carderock Division (NSWCCD) located in Bethesda, Maryland, took this photograph of a 3-50-caliber gun mounted on the s
vehiclewater
US Navy 071227-N-0193M-562 Fire Controlman 1st Class Leland Allen paints the wall in the Essikado hospital maternity ward as a volunteer for Africa Partnership Station (APS) in Takoradi, Ghana
united states navy in sekondi-takoradifire controlman
Delahaye Fire Engine '924 AP 62' Sapeurs Pompiers Ville de Therouanne, Musée de l'Epopée de l'Industrie et de l'Aéronautique, pic 1
vehiclecc-zero
Volvo P13194 dutch licence registration 45-72-AP pic3
vehiclecar
Volvo P13194 dutch licence registration 45-72-AP pic1
vehiclecar
Young animal animal portrait
animalsnature
Delahaye Fire Engine '924 AP 62' Sapeurs Pompiers Ville de Therouanne, Musée de l'Epopée de l'Industrie et de l'Aéronautique, pic 2
vehiclecar
Volvo P13194 dutch licence registration 45-72-AP pic2
vehiclecar
Giant Alocasia in Botanic garden Mont Fleuri in Victoria on Mahé Island. Photo by Anatoly Terentiev, 13 April 2007.
treeapes
US Navy 071120-N-8933S-099 Rear Adm. Tony Kurta, director for Policy, Resources and Strategy, U.S. Naval Forces Europe, speaks at the Africa Partnership Station (APS) ground-breaking ceremony commemorating the initial construct
united states navy in temaanthony m. kurta
US Navy 100408-N-6676S-039 Senegal army Col. Antoine Wardini, left, speaks with Capt. Cindy Thebaud, commander of Africa Partnership Station (APS) West
africa partnership station 2010cynthia m. thebaud
US Navy 100126-N-7948C-071 Lt. Cmdr. Samuel Ayelazono, center, from Ghana, assigned to Africa Partnership Station (APS) West staff aboard the amphibious dock landing ship USS Gunston Hall
aboard uss gunston hall (lsd-44)people
US Navy 100412-N-6138K-381 Ensign Michael Manaskie shows APS students how to use a nautical navigation chart aboard the amphibious dock landing ship USS Gunston Hall (LSD 44)
aboard uss gunston hall (lsd-44)navy of togo
US Navy 111026-N-YM440-002 Rear Adm. Eleanor Valentin, commander of the Navy Medicine Support Command and director of the Medical Service Corps, ap
lighttexas
Chimp
wildlifeanimals
Monkey
wildlifeanimals
King Kong
animalsfantasy
Portrait of Vibia Sabina, wife of Emperor Hadrian. Marble, ca. 135 CE. Français : Portrait de Sabine, épouse de l'empereur Hadrien. Marbre, vers 135 ap. J.-C. Provenance: Via Appia.
lepidopterapieridae
Grape-guzzling ape, by Joseph Bonaventura Mutschele, Nuremberg, c. 1762, sandstone - Germanisches Nationalmuseum - Nuremberg, Germany - DSC02753
self-published workcc-pd-mark
US Navy 080116-N-1429M-001 A student from Belise Elementary School dances to music from members of the Africa Partnership Station (APS) band
united states naval forces europe bandafrica partnership station 2008
US Navy 071204-N-8933S-058 Cameroonian sailors salute Capt. John B. Nowell Jr., commodore, Africa Partnership Station (APS), on the departure from Limbe Naval Base after discussions of training and construction projects
armyjr
Animal nature primate
characteranimals
Animal nature primate
characteranimals
Animal nature primate
characteranimals
Auratus background behavior
backgroundanimals
Alocasia macrorrhizos specimen in the Jardin botanique du Val Rahmeh, Menton, Alpes-Maritimes, France.
peopleapes
US Navy 080130-N-0193M-206 The Commander, Naval Forces Europe Brass Quartet performs at the Centre d' Accueil Orphanage during a visit by Africa Partnership Station (APS) Sailors
celebritiesgroup
US Navy 071211-N-0193M-145 Construction Electrician 2nd Class Jose Castillo, center, takes time as an Africa Partnership Station (APS) volunteer to shows Limbe United Youth Associations volunteers how to secure chicken wire
africa partnership station 2007human trafficking
Animal nature primate
characteranimals
Monkey
characteranimals
Chimpanzee
wildlifeanimals
US Navy 080107-N-4044H-052 Capt. Paul Biving Nziengui, chief of the Gabonese National Navy, speaks to national media aboard Africa Partnership Station (APS) dock landing ship USS Fort McHenry (LSD 43)
aboard uss fort mchenry (lsd-43)united states military in gabon
Dishes with ape leaf design, Hawaiian Potters Guild, Honolulu Museum of Art
earthenwaregreen plate
Infant south africa hartbeespoort
animalsnature
US Navy 080114-N-8933S-158 Gabonese Navy Quartermaster 1st Class Mavoungou Souamy Armstrong climbs a ladder while learning basic visit, board, search and seizure techniques from Africa Partnership Station (APS) Sailors
people of the national navy of gabonaboard uss fort mchenry (lsd-43)
Orangutan Hanging from a Tree
animalsmammals
Forest wild life
animalstravel
Baboon
wildlifeanimals
Friendly monkey face
animalsmonkey
Hanging monkey
animalsmonkey
Ape with young, Etrusco-Corinthian perfume holder, 560-540 BC, inv. 16478 - Museo Gregoriano Etrusco - Vatican Museums - DSC01066
self-published workcc-pd-mark
US Navy 071104-N-0193M-104 Lt. A.S. Omotosho, a Nigerian navy officer embarked with Africa Partnership Station (APS), talks with Cmdr. Martin Pompeo, commanding officer of USS Fort McHenry (LSD 43), during a steel beach picnic
watership
US Navy 080129-N-0193M-199 Africa Partnership Station (APS) volunteers Mineman 1st Class Philip Phillips, right, and Mineman 2nd Class Matthew Rishovd stack boxes on to a truck to be shipped to malnourished children as part of
aboard hsv-2 swiftmineman
Monkey
wildlifejungle
Chimpanzee
rainforest animalsanimals
US Navy 070328-N-3642E-027 Secretary of the Navy (SECNAV), the Honorable Dr. Donald C. Winter, Chief of Naval Operations (CNO) Adm. Mike Mullen and Commandant of the Marine Corps Gen. James T. Conway appear before the Senate Ap
michael g. mullen in 2007inside
US Navy 080113-N-8933S-043 Information Systems Technician 2nd Class Mark Heier, assigned to the amphibious dock landing ship USS Fort McHenry (LSD 43) as part of Africa Partnership Station (APS), plays soccer with local Gabones
association football in the united states navyafrica partnership station 2008
US Navy 080122-N-8933S-238 Africa Partnership Station (APS) Sailors move hospital beds from a landing craft utility to a local hospital designated from Project Handclasp
hospital bedpeople
US Navy 080211-N-0193M-096 Cmdr. Charles Rock, commanding officer of the Africa Partnership Station (APS) high speed vessel Swift (HSV 2), speaks with the press about the delivery of 27 pallets
united states navy in doualagaroua
US Navy 080208-N-0577G-092 Staff Sgt. William Sudbrock of Vero Beach, Fla., a Marine assigned to Africa Partnership Station (APS), begins the first day of martial-arts instruction for the 2nd Infantry Battalion of the Ghanaian
united states navy in sekondi-takoradipeople of the ghana army
US Navy 080208-N-0577G-140 Staff Sgt. Franklin Davis, of East Brunswick, N.J., a Marine assigned to Africa Partnership Station (APS) begins the first day of martial-arts instruction for the 2nd Infantry Battalion of the Ghanaia
united states navy in sekondi-takoradipeople of the ghana army
US Navy 080213-N-0577G-010 Africa Partnership Station (APS) Sailors load Project Handclasp medical supplies onto a supply truck for donation to the Ghanaian Navy Western Command hospital
united states navy in sekondi-takoradiaboard hsv-2 swift
Monkeys
characteranimals
US Navy 080107-N-4044H-076 Cmdr. Martin Pompeo, commanding officer aboard Africa Partnership Station (APS) dock landing ship USS Fort McHenry (LSD 43), explains the procedure for fixing a metal antenna bracket for a rigid hull
aboard uss fort mchenry (lsd-43)eunice s. reddick
US Navy 080130-N-0193M-093 Mineman 1st class April Morehouse, an Africa Partnership Station (APS) volunteer assigned to the high speed vessel Swift (HSV 2) is taught how to weave a basket by a young girl at the Centre d' Accuei
basketrymineman
US Navy 090119-N-1688B-363 British Cmdr. Mark Fitzsimmons, director of staff for Africa Partnership Station (APS) 2009, fires the M-240 machine gun while aboard the amphibious transport dock ship USS Nashville (LPD 13)
militarynavy
US Navy 090119-N-1688B-300 Capt. Cindy Thebaud, commander, Africa Partnership Station (APS) 2009, receives training on the M-240 machine gun while aboard the amphibious transport dock ship USS Nashville (LPD 13)
militarynavy
US Navy 100118-N-2468S-001 The guided-missile frigate USS Samuel B. Roberts (FFG 58) prepares to moor for a port visit at Pointe Noire, Republic of Congo as part of Africa Partnership Station (APS) West. While in port, Samuel
shipnavy
Tree apple tree unsprayed
foodtree
Aerial sunlight flying
travelwater
Monkeys
characteranimals
Monkeys
characteranimals
Monkey
monkeyapes
Security
martial artsmonkey
Monkeys
characteranimals
US Navy 071204-N-8933S-152 The amphibious dock landing ship USS Fort McHenry (LSD 43) sits anchored off of the coast of Limbe. Africa Partnership Station (APS) is aboard Fort McHenry conducting training for Cameroonian Sailors
destroyer squadron 60ship at anchor
US Navy 080113-N-8933S-073 Engineman 3rd Class Lawrence Cofie, assigned to the amphibious dock landing ship USS Fort McHenry (LSD 43) as part of Africa Partnership Station (APS), plays soccer with local Gabonese soccer players
fieldgame
US Navy 071105-N-0193M-500 Boatswain's Mate 1st Class Jay Collette directs line handlers from the flight deck of USS Fort McHenry (LSD 43) during the Africa Partnership Station (APS) arrival in Dakar, Senegal
aboard uss fort mchenry (lsd-43)walkie talkie
US Navy 080107-N-4044H-049 Capt. John B. Nowell Jr., commodore, Africa Partnership Station (APS) is greeted by Gabonese Army as he arrives at a scheduled meeting with General Ntori Longo, chief of Gabonese Armed Services, about
gabonjr
US Navy 100308-N-7948C-091 U. S. Navy Capt. Cindy Thebaud, second from right, commander of Africa Partnership Station (APS) West, tours the Nigerian Naval Dock Yard with Nigerian navy Capt. Dan Agundi
united states navy in lagoscynthia m. thebaud
Monkey
animalssymbol
Monkey
characteranimals
Monkey
characteranimals
US Navy 080111-N-8933S-030 Gabonese sailors board Africa Partnership Station (APS) for training to enhance their regional and maritime safety and security aboard the amphibious dock landing ship USS Fort McHenry (LSD 43)
vehiclecar
US Navy 080122-N-8933S-464 Africa Partnership Station (APS) Sailors and Sao Tomeain military personnel move hospital beds from a landing craft utility to a local hospital designated from Project Handclasp
project handclasp (united states navy)hospital bed
Gorilla
rainforest animalsanimals
King kong
animalsfantasy
Baboon face
animalsmonkey
US Navy 100121-N-XXXXH-098 Constructionman 1st Class Robert Taylor, an Africa Partnership Station (APS) East instructor, teaches a small boat maintenance course to Tanzanian maritime students in Dar Es Salaam, Tanzania
africa partnership station 2010boat
US Navy 080111-N-4044H-001 Boatswain's Mate 1st Class Tracy Bivins explains basic knot tying techniques to Gabonese sailors as part of training by Africa Partnership Station (APS)
militaryarmy
US Navy 100308-N-7948C-260 Capt. Cindy Thebaud, commander of Africa Partnership Station (APS) West, tours a navigation simulator at the Joint Maritime Training Center at Nigeria Naval Station Quorra
ship bridge simulatorscynthia m. thebaud
US Navy 100312-N-7948C-033 Italian navy Lt. Cmdr. Marco Compasso, assigned to Africa Partnership Station (APS) West staff, speaks with a Ghanaian Sailor during a maritime domain awareness workshop aboard the amphibious dock lan
united states navy in sekondi-takoradiaboard uss gunston hall (lsd-44)
US Navy 100403-N-6138K-931 Capt. Cindy Thebaud, commander of Africa Partnership Station (APS) West, speaks to Armed Forces of Liberia Coast Guardsmen while transiting to the amphibious dock-landing ship USS Gunston Hall (LSD 44
cynthia m. thebaudarmy
Monkey face
animalsmonkey
Byeongsinnyeon
childrenanimals
Chimpanzee
animalsjungle
1501 - 1600 of 3,580 Next page
/ 36